KEGG   Caldicellulosiruptor lactoaceticus: Calla_0563Help
Entry
Calla_0563        CDS       T01600                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:clc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Calla_0563
   00052 Galactose metabolism
    Calla_0563
   00500 Starch and sucrose metabolism
    Calla_0563
   00520 Amino sugar and nucleotide sugar metabolism
    Calla_0563
Enzymes [BR:clc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Calla_0563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
622875..623783
Genome map
AA seq 302 aa AA seqDB search
MRRLIKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEALESGIESILVVTGR
GKRAIEDHFDKSFELEVALENKKDYDNLQLIRKIADYNVHYIRQKEPRGLGDAVYCARLF
IDNEPFAVLLGDDIIISEKPCLKQLIEVYEEYRTTILGVQKVPEEDVSKYGIVAGKQIED
RIYKVKDLVEKPKKEEAPSNIAVLGRYIITPEILNILQHTKEGVGGEIQLTDALRELSKK
EAMYAYEFEGKRYDVGNKLGFLQATVEIALSREDIGKDFYNYLVTLVNAKNYKEKLNELD
KI
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaggcttatcaaaaaagcaatcattcctgcggcaggacttgggacaaggtttttg
ccggcaacaaaagcacagcccaaagagatgcttcccattgtggacaagccaacaattcaa
tacatagttgaagaggcgttagaatcggggatagagagcattttggttgtcacagggcgt
ggcaaaagggcaattgaggaccattttgacaagtcttttgagcttgaggttgcgctcgaa
aacaaaaaggattatgacaatcttcaattgataagaaagatagcagattacaatgttcat
tacatacgtcaaaaagagccaagagggcttggagatgcagtgtattgtgcaagacttttt
atcgacaatgaacctttcgcagttttgcttggagatgacatcatcatttctgaaaagcca
tgtttaaaacagctgatagaggtgtatgaagagtacaggacaaccatcttgggtgtgcaa
aaagtaccagaggaggatgttagcaagtacggaattgttgcaggaaaacagatagaagat
agaatctataaggtaaaagacctcgttgaaaagccaaaaaaggaagaagcaccttcgaat
attgctgtgcttggaagatatatcataactccggagatattaaatattctacaacataca
aaagaaggcgttggtggcgagattcaattgactgatgctttaagagagttatctaaaaaa
gaagctatgtatgcttatgagtttgaagggaaaagatatgatgttggcaataaacttgga
tttttgcaggcaacagtcgaaattgctctttcaagggaagacattggcaaagatttttat
aactatcttgttactcttgtaaatgctaagaattataaagaaaagttgaatgagttagat
aagatttaa

DBGET integrated database retrieval system