KEGG   Caldicellulosiruptor lactoaceticus: Calla_0653Help
Entry
Calla_0653        CDS       T01600                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:clc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Calla_0653
   01230 Biosynthesis of amino acids
    Calla_0653
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calla_0653
   00030 Pentose phosphate pathway
    Calla_0653
   00051 Fructose and mannose metabolism
    Calla_0653
   00052 Galactose metabolism
    Calla_0653
  Energy metabolism
   00680 Methane metabolism
    Calla_0653
Enzymes [BR:clc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Calla_0653
Protein phosphatases and associated proteins [BR:clc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Calla_0653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
713234..714202
Genome map
AA seq 322 aa AA seqDB search
MPEVRTIGVLTSGGDAPGMNAAIRAVVRTGIYYGFRVMGIRRGYNGLIEGDIFEMNLRSV
SDIIQRGGTILLTARSPEFMTENGLKKAASMCKIFKIDALVVIGGDGSFRGARDLSKFGI
NVVGIPGTIDNDIACTDYTIGFDTALNTVQDAINKIRDTATSHERVSILEVMGRHAGYIA
LYSGIAGGAESIVIPEKGLDKDEIIRRIIDGKNKGKLHNLIILAEGIGGATELAKEIEEA
TGIETRATILGYIQRGGSPTAYDRVVASLMGAKAVEVIKEGKQNRIIAMKDGKIVDYDID
EALSMQKTIDEYMYNLATILSL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagtgagaactattggtgttttgacaagtggtggagacgcaccgggaatgaat
gcggctattcgtgctgttgtaagaactggtatatactacgggtttagagttatgggcata
agacgaggctataatggtcttattgaaggcgacatttttgagatgaacctgaggtctgtt
tcagatataatccaacgtggtggaacaatacttttgactgcaaggtctcctgagttcatg
acagaaaatgggctcaaaaaagctgcttcaatgtgcaaaatctttaagattgatgctctt
gttgtaattggtggagatgggtctttcaggggagcaagagacctgagtaagtttggtata
aatgttgttggaattcctggaaccatcgataatgacatcgcatgtacagactacactatt
ggttttgatacagcattgaatactgtacaggatgcaattaataagataagagacacggca
acctctcatgaaagagttagcatccttgaagtaatgggacgtcatgctggatatattgct
ctttatagcggtattgcaggcggtgctgagtcaattgtgattcccgaaaaaggtcttgac
aaagatgagataatcagaagaataattgatggcaaaaacaaaggaaagcttcataacttg
attatattggctgagggaattggtggagcaacagaacttgcaaaggagattgaagaagca
acaggaatagagacaagggcgacaatacttggatatatccagagaggtggatcgcctact
gcatatgacagagttgttgcaagtttgatgggggcaaaggctgttgaggttatcaaagaa
ggtaagcagaacaggataattgcgatgaaggatggcaagattgttgattatgatattgac
gaagcactttctatgcaaaagacaattgatgaatacatgtacaacttagctactattctt
tctttataa

DBGET integrated database retrieval system