KEGG   Caldicellulosiruptor lactoaceticus: Calla_0653Help
Entry
Calla_0653        CDS       T01600                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:clc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:clc01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:clc00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:clc00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:clc00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:clc00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:clc00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
713234..714202
Genome map
AA seq 322 aa AA seqDB search
MPEVRTIGVLTSGGDAPGMNAAIRAVVRTGIYYGFRVMGIRRGYNGLIEGDIFEMNLRSV
SDIIQRGGTILLTARSPEFMTENGLKKAASMCKIFKIDALVVIGGDGSFRGARDLSKFGI
NVVGIPGTIDNDIACTDYTIGFDTALNTVQDAINKIRDTATSHERVSILEVMGRHAGYIA
LYSGIAGGAESIVIPEKGLDKDEIIRRIIDGKNKGKLHNLIILAEGIGGATELAKEIEEA
TGIETRATILGYIQRGGSPTAYDRVVASLMGAKAVEVIKEGKQNRIIAMKDGKIVDYDID
EALSMQKTIDEYMYNLATILSL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagtgagaactattggtgttttgacaagtggtggagacgcaccgggaatgaat
gcggctattcgtgctgttgtaagaactggtatatactacgggtttagagttatgggcata
agacgaggctataatggtcttattgaaggcgacatttttgagatgaacctgaggtctgtt
tcagatataatccaacgtggtggaacaatacttttgactgcaaggtctcctgagttcatg
acagaaaatgggctcaaaaaagctgcttcaatgtgcaaaatctttaagattgatgctctt
gttgtaattggtggagatgggtctttcaggggagcaagagacctgagtaagtttggtata
aatgttgttggaattcctggaaccatcgataatgacatcgcatgtacagactacactatt
ggttttgatacagcattgaatactgtacaggatgcaattaataagataagagacacggca
acctctcatgaaagagttagcatccttgaagtaatgggacgtcatgctggatatattgct
ctttatagcggtattgcaggcggtgctgagtcaattgtgattcccgaaaaaggtcttgac
aaagatgagataatcagaagaataattgatggcaaaaacaaaggaaagcttcataacttg
attatattggctgagggaattggtggagcaacagaacttgcaaaggagattgaagaagca
acaggaatagagacaagggcgacaatacttggatatatccagagaggtggatcgcctact
gcatatgacagagttgttgcaagtttgatgggggcaaaggctgttgaggttatcaaagaa
ggtaagcagaacaggataattgcgatgaaggatggcaagattgttgattatgatattgac
gaagcactttctatgcaaaagacaattgatgaatacatgtacaacttagctactattctt
tctttataa

DBGET integrated database retrieval system