KEGG   Caldicellulosiruptor lactoaceticus: Calla_0687Help
Entry
Calla_0687        CDS       T01600                                 

Definition
hydrogenase, Fe-only
Orthology
K00336  
NADH-quinone oxidoreductase subunit G [EC:1.6.5.3]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
Oxidative phosphorylation
Metabolic pathways
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:clc00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
746485..748224
Genome map
AA seq 579 aa AA seqDB search
MEMVNITIDGKKIQVPKDYTVLQAAREAGVEIPTLCYLKGINEIGACRMCVVEVKGARSL
QAACVYPVSEGMEVITNSERVRRARKVNLELILSNHDRSCLTCVRSGNCELQKLAEDLNV
KQIRYEGENIRRPLDDFSPSVVRDPNKCILCKRCINVCRNVQEVGVINANYRGFRTVIST
AFDRSLNDVACTMCGQCIQACPVGALREKDSTDIVWKALADKNKYVVVQTAPAVRVALGE
EFGLPIGTRVTGKMVTALKMLGFDKVFDTDTGADLTIMEEGTELINRIKNGGKLPLITSC
SPGWIKFCEHYFPEFLDNLSTCKSPHEMFGAILKTYFAQKMGIDPANMFVVSIMPCTAKK
FEAQREELAASGYPDVDAVLTTRELARMIKEAGIDFVNLPDSHFDDPMGDATGAGVIFGT
TGGVMEAALRTVYEVLTGKTLENVEITQVRGLEGIREAEIDVGSMKIKAAVAHGLANAKK
LLEMVKNGEKEYHFIEIMACPGGCIMGGGQPIVPAKVKEKIDVAKLRASAIYDEDRSLPI
RKSHENPAVKRLYEEFLGHPNSEKAHHILHTHYKKRPLY
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggtgaatataacaatagatggcaagaagattcaggtgccaaaggattataca
gtgcttcaagcagcacgcgaagcaggagttgagattccaaccctgtgttatctcaaaggt
ataaatgaaattggtgcttgcagaatgtgcgttgttgaagtaaaaggggcaagaagcttg
caggctgcttgtgtctaccctgtatcagaaggcatggaggtcatcacaaacagtgaaagg
gtaagaagagcaagaaaggtcaatcttgagcttattctttcaaatcatgacaggagctgc
ttgacatgtgtcagaagcggaaactgtgaacttcaaaaacttgcagaagatttaaatgtt
aagcaaattagatatgaaggcgaaaatataagaagacctcttgatgatttttcaccttct
gttgtaagagatccaaataagtgtatactctgtaaaagatgtataaatgtttgcaggaat
gttcaagaggttggagttataaatgcaaattacagaggtttcagaacagttatatccact
gcatttgacagaagtctaaatgatgttgcatgtacaatgtgcggtcaatgtattcaggct
tgcccagttggagctttaagagaaaaagactcaacagacattgtatggaaggctttagca
gacaagaacaaatatgtggttgttcaaacagctccagctgtcagagttgcacttggtgaa
gagtttggacttccaattggtacaagagttaccggcaagatggtaactgctctcaagatg
cttgggtttgacaaagtatttgatacagacacaggcgcagaccttaccattatggaagaa
ggtacagagttaataaatagaatcaaaaatggcggtaaacttcctcttattacttcttgt
tctccgggatggattaagttctgtgaacactacttcccagaatttttagataatttatct
acctgcaaatcaccacatgagatgtttggtgctattttaaagacatactttgcacagaaa
atgggaattgaccctgcgaacatgtttgttgtgtctatcatgccatgtactgctaagaaa
ttcgaagctcaaagggaagaacttgcggcaagtggatatccagatgttgatgcagtattg
acgacaagagagctcgcaagaatgataaaagaagcgggaattgactttgtgaacttgccg
gatagccactttgacgacccaatgggagatgcaacaggtgcaggtgtcatctttggaaca
acaggcggtgtaatggaagcagcactgcgaactgtatatgaagtgctaacaggaaaaaca
cttgaaaatgtcgaaattactcaagttcgtggccttgaaggaataagagaggctgagatt
gacgtcggcagtatgaagattaaagcagctgttgcacatggtcttgcaaacgctaaaaaa
cttcttgagatggtcaaaaacggtgaaaaagagtatcactttatagaaatcatggcatgc
cctggcggatgcataatgggtggaggtcagccaattgttcctgcaaaggtcaaggagaaa
atagatgttgcaaagctcagagcaagcgcaatatacgatgaggataggtccctgccaata
agaaagtctcatgaaaaccctgctgtaaaaagattatatgaagagttcttaggtcatcca
aatagcgaaaaagctcatcatattttgcatacacactataagaaaagaccactgtactaa

DBGET integrated database retrieval system