KEGG   Caldicellulosiruptor lactoaceticus: Calla_0703Help
Entry
Calla_0703        CDS       T01600                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Calla_0703
Enzymes [BR:clc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Calla_0703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
761407..762264
Genome map
AA seq 285 aa AA seqDB search
MGFNLYKPSFLCATEDYQASTIVLAGVPMDFTVSFKPGSRFAPAKIREVSIELEEYSIYQ
DKSLYDKTFCDMGDLELPFGNIERSIETIYQFACKLFEERKVPIFLGGEHLISFPLIKAA
ANSTDEELYVLHFDAHADMREEYLGEKFSHATVMRRVGEVLGFKNIYQFGIRSGSKEEIE
FAKKNSNLYLVDKWGKIDDVIKNLKGKKVYLSIDIDVFDPAFAPGTGTPEPGGILSADFF
DILLKLKDLDIIGADIVEVAPYYDISDRTALLAAKIVRELILMIE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgggctttaatctctacaaaccttcttttctatgtgcaacagaagattaccaagcaagt
accatagttttagcaggagttcctatggattttacagtgagctttaaacctggttcgcgt
tttgctcctgcaaagataagagaagtgtcaatagagctggaggagtattctatctatcag
gacaaaagcctttatgataagaccttttgtgatatgggagatttagagcttccttttgga
aatattgaaagaagtattgagacaatatatcagtttgcttgtaagctgtttgaagaaaga
aaagtccctattttcttgggtggtgaacatctaattagttttcctctaataaaggcggca
gcaaattcaactgatgaagagttgtatgtacttcactttgatgctcatgctgatatgaga
gaagagtatcttggtgaaaagttttcacatgccactgttatgagaagagtgggtgaggtt
ttaggctttaagaatatataccagtttggtataaggtcggggtcaaaagaagaaattgaa
tttgcaaaaaagaatagcaatctttatttggttgacaaatggggtaaaattgatgatgta
ataaaaaatttaaaaggcaaaaaggtatacctatcgatagatatagatgtttttgacccg
gcttttgcacctggtacaggaacacctgagccaggcggaattctatctgcggattttttt
gacattttacttaaattaaaggacctcgatataataggagcagacatagtggaagttgct
ccatactacgatatttctgacagaacagcacttcttgccgcaaagatagtaagagagctg
atattgatgatagagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system