KEGG   Caldicellulosiruptor lactoaceticus: Calla_0755Help
Entry
Calla_0755        CDS       T01600                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Calla_0755
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Calla_0755
Enzymes [BR:clc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Calla_0755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
810962..811879
Genome map
AA seq 305 aa AA seqDB search
MKHLLGLRDLSKEDIIKILNLAKDMKTILKSETKKTPHLQGYSVVTLFYENSTRTRTSFE
LAAKFMSANTTSISVQTSSVQKGESLLDTVKTLEALKTDVLIVRHSVSGVPHFIAKNCSF
SVINAGDGMNEHPTQALLDMFTIRERLGTIEKLKIAIIGDILHSRVARSNIWGLSKFDNQ
ITVFGPQTLIPPYIENFAEVASSLEEAVSGKDVVIDLRIQLERQKRGFITSKQEYYKFYG
LNEDIMRYISGSTLIMHPGPVNRGVEISSEVMQLPNSTIDEQVTNGIAVRMAILYLCTRK
EGIYR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacatttgcttgggctaagagatctttcaaaagaggatatcataaaaatactgaat
cttgcaaaagatatgaagacaattttaaagagtgaaactaaaaagactccacatctgcaa
gggtattcggttgtaactctgttttatgaaaatagcaccaggacacgaacatcgtttgag
cttgcagcaaagtttatgagtgcaaatacaacctctatatcagtgcaaaccagcagtgta
caaaaaggagaatctttgcttgatactgtaaaaactttggaagctctaaaaacagatgtg
ctaattgtcagacattcagtctctggtgtgccgcattttattgcaaaaaattgttcattt
tcggtcataaacgctggtgatggaatgaacgagcatccaacacaggcactgcttgatatg
tttacaattagagaaaggcttggaacaattgagaaattgaagatagcaatcattggcgat
attcttcacagcagggttgcaaggagcaacatatggggactttctaagtttgacaaccaa
atcacagtgtttgggccacaaacacttattccaccttatattgaaaactttgctgaggtt
gcatcttctttagaagaggcagtctcaggaaaagatgttgtaatagatttgaggattcag
cttgagagacaaaaacggggctttataacctcaaaacaagagtattacaaattttatgga
ttaaacgaagatataatgaggtatatttcaggcagcaccctgataatgcaccctggtcct
gtcaacaggggagtagaaatttcttcagaggtgatgcagctgccaaattctacaattgat
gagcaggttacaaacggtattgctgttagaatggcaattttatatctttgtacgcgcaag
gagggaatttataggtga

DBGET integrated database retrieval system