KEGG   Caldicellulosiruptor lactoaceticus: Calla_0755Help
Entry
Calla_0755        CDS       T01600                                 

Definition
(GenBank) Aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
clc00240  Pyrimidine metabolism
clc00250  Alanine, aspartate and glutamate metabolism
clc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Calla_0755
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Calla_0755
Enzymes [BR:clc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Calla_0755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace T_Ag_DNA_bind
Motif
Other DBs
NCBI-ProteinID: AEM73407
JGI: Calla_0755
UniProt: G2PTT9
Position
810962..811879
Genome map
AA seq 305 aa AA seqDB search
MKHLLGLRDLSKEDIIKILNLAKDMKTILKSETKKTPHLQGYSVVTLFYENSTRTRTSFE
LAAKFMSANTTSISVQTSSVQKGESLLDTVKTLEALKTDVLIVRHSVSGVPHFIAKNCSF
SVINAGDGMNEHPTQALLDMFTIRERLGTIEKLKIAIIGDILHSRVARSNIWGLSKFDNQ
ITVFGPQTLIPPYIENFAEVASSLEEAVSGKDVVIDLRIQLERQKRGFITSKQEYYKFYG
LNEDIMRYISGSTLIMHPGPVNRGVEISSEVMQLPNSTIDEQVTNGIAVRMAILYLCTRK
EGIYR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacatttgcttgggctaagagatctttcaaaagaggatatcataaaaatactgaat
cttgcaaaagatatgaagacaattttaaagagtgaaactaaaaagactccacatctgcaa
gggtattcggttgtaactctgttttatgaaaatagcaccaggacacgaacatcgtttgag
cttgcagcaaagtttatgagtgcaaatacaacctctatatcagtgcaaaccagcagtgta
caaaaaggagaatctttgcttgatactgtaaaaactttggaagctctaaaaacagatgtg
ctaattgtcagacattcagtctctggtgtgccgcattttattgcaaaaaattgttcattt
tcggtcataaacgctggtgatggaatgaacgagcatccaacacaggcactgcttgatatg
tttacaattagagaaaggcttggaacaattgagaaattgaagatagcaatcattggcgat
attcttcacagcagggttgcaaggagcaacatatggggactttctaagtttgacaaccaa
atcacagtgtttgggccacaaacacttattccaccttatattgaaaactttgctgaggtt
gcatcttctttagaagaggcagtctcaggaaaagatgttgtaatagatttgaggattcag
cttgagagacaaaaacggggctttataacctcaaaacaagagtattacaaattttatgga
ttaaacgaagatataatgaggtatatttcaggcagcaccctgataatgcaccctggtcct
gtcaacaggggagtagaaatttcttcagaggtgatgcagctgccaaattctacaattgat
gagcaggttacaaacggtattgctgttagaatggcaattttatatctttgtacgcgcaag
gagggaatttataggtga

DBGET integrated database retrieval system