KEGG   Caldicellulosiruptor lactoaceticus: Calla_1103Help
Entry
Calla_1103        CDS       T01600                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
clc00260  Glycine, serine and threonine metabolism
clc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
clc01100  Metabolic pathways
clc01110  Biosynthesis of secondary metabolites
clc01130  Biosynthesis of antibiotics
clc01230  Biosynthesis of amino acids
Module
clc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:clc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Calla_1103
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Calla_1103
Enzymes [BR:clc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Calla_1103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB DUF627
Motif
Other DBs
NCBI-ProteinID: AEM73736
JGI: Calla_1103
UniProt: G2PW18
Position
complement(1174313..1175083)
Genome map
AA seq 256 aa AA seqDB search
MNLIDERFERLKKEGKKAFIGYVTFGYPSFEETLGFIKLVYSYVDILEIGFPFSDPIADG
EIIQKASIKALSEGVKLSHLFESIEKFKKDKPVVLMLYANTVYKRGIDRFFESSKACGVD
GVIIPDVSFEESFEFKEAAEKFGVTYIDLVSISSLERAKMIGKQSKGFLYCVSRKGVTGF
KGQIDDRIFTFLRELKTVTPTPLAVGFGIKGKEDVQKFKDLADGIVIGSAIITKIDEGKD
KLEDFLKEISESLKDK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaatagatgaaagatttgaaaggctaaaaaaagagggaaaaaaagctttcata
ggctatgtaacgtttgggtatccctcttttgaagagacacttgggtttataaagcttgta
tattcatatgtagacattttagagattggttttcctttttctgaccctattgcagatggt
gaaattattcaaaaagcttctataaaagctcttagtgaaggtgttaaattgagccacctt
tttgaaagcattgaaaagtttaaaaaagataagccggttgtgctaatgctgtatgcaaac
acagtttacaaaaggggaattgataggttttttgaaagtagcaaagcttgcggtgtagat
ggcgttataatccccgatgtttcgttcgaggagagctttgagttcaaagaagcagctgaa
aagtttggtgttacttatattgaccttgtatctatatcttctcttgagagagccaagatg
ataggtaagcagtctaaaggttttttgtactgtgtttcaagaaaaggcgtgacaggtttt
aaagggcagattgatgacaggatttttactttcttgagagaactgaaaactgttacccca
acacctttggcagttgggtttggtataaagggtaaagaagatgttcagaagttcaaagac
cttgcagatggtattgtcattggaagcgcaataatcacaaagatagatgaagggaaagac
aagcttgaagatttcttgaaagaaatttctgaaagtctaaaagacaaataa

DBGET integrated database retrieval system