KEGG   Caldicellulosiruptor lactoaceticus: Calla_1122Help
Entry
Calla_1122        CDS       T01600                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
clc00010  Glycolysis / Gluconeogenesis
clc00020  Citrate cycle (TCA cycle)
clc00620  Pyruvate metabolism
clc00633  Nitrotoluene degradation
clc00640  Propanoate metabolism
clc00650  Butanoate metabolism
clc00680  Methane metabolism
clc01100  Metabolic pathways
clc01120  Microbial metabolism in diverse environments
clc01130  Biosynthesis of antibiotics
clc01200  Carbon metabolism
Module
clc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:clc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calla_1122
   00020 Citrate cycle (TCA cycle)
    Calla_1122
   00620 Pyruvate metabolism
    Calla_1122
   00640 Propanoate metabolism
    Calla_1122
   00650 Butanoate metabolism
    Calla_1122
  Energy metabolism
   00680 Methane metabolism
    Calla_1122
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Calla_1122
Enzymes [BR:clc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Calla_1122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Fer4 Fer4_6 Fer4_16 Fer4_7 Fer4_9 Fer4_21 Fer4_2 Fer4_17 Fer4_10 Fer4_4 Fer4_8 Fer4_22 Fer4_3 Fer4_13 Phage_TAC_9
Motif
Other DBs
NCBI-ProteinID: AEM73755
JGI: Calla_1122
UniProt: G2PWI7
Position
complement(1195574..1196593)
Genome map
AA seq 339 aa AA seqDB search
MLPTTNELGYYEIRLESIGGLGANVAGKILAEAGVVGSGLNALNFASYGSEKKGSPVKSY
IRFAPKEKQIRINSPVVQPHLVAIFHENMVNTNPVTQGLRKDGIVILNTSKSVDEARDFL
KLASGTVATVDAIRIALEVKTRINMVMLGAIVRMLGFISLDSVKEIVKQTFEKKYPQTIA
SNMAGLEAGYNQVESKFFEYDGKYQYVEYQEERRPMGYKNAPIGGTIVEYANTITKNNIT
SRIGKIPVFIKEKCINCGLCETTCPDYVFVWDRRIENGKLKMFNLGPDYQYCKGCLRCVD
ICPTGALVEGIEREYDIEKISAKHDFDIYEKWYEDGEKR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgttaccaactacaaacgaacttggatactacgaaattcgacttgaaagtattggcgga
cttggtgcaaatgttgcgggcaagattttggctgaggcaggtgttgttggaagtggacta
aatgccttaaattttgcaagttatggctctgaaaagaaaggttcgcctgtaaagtcgtat
ataagatttgctccaaaggaaaagcagataagaattaattcgcctgttgttcagcctcat
ctggttgctatattccacgaaaatatggtaaatacaaaccccgtcacacaaggacttaga
aaagatggaatagttatcctgaacacaagcaagagcgtggatgaggctcgagacttttta
aaacttgcaagtggcacggtggcaacagtggatgcaataaggattgctcttgaagttaaa
acaaggattaacatggttatgcttggggcaattgtaagaatgcttgggtttatcagctta
gatagcgtgaaagagattgttaaacaaacttttgagaaaaaatatccacagacaattgcg
tccaacatggcaggtcttgaagctggatataaccaggtagaatctaagttttttgaatat
gatggtaaataccaatacgtagagtaccaggaagaaagaagacctatgggatataaaaac
gctccgattggaggaactattgtagaatatgcaaacacaataacaaaaaacaatataacc
agcaggattgggaaaattcctgtgtttataaaagaaaaatgcatcaactgtgggctttgt
gaaacaacatgccctgattatgtctttgtttgggatagaaggattgaaaatggtaagtta
aagatgtttaatctgggacctgattatcaatattgtaaaggatgcctaagatgtgttgat
atttgtcctacaggtgcacttgttgaaggaattgaaagggaatatgacatagaaaaaatc
tctgcaaaacatgattttgatatatatgaaaaatggtatgaggatggtgagaagagatga

DBGET integrated database retrieval system