KEGG   Caldicellulosiruptor lactoaceticus: Calla_1292Help
Entry
Calla_1292        CDS       T01600                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:clc01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:clc00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1356245..1358005)
Genome map
AA seq 586 aa AA seqDB search
MIGKDFIRVLYIDLTNKKADIQERKDLYKYLGGAGVAAKLLEENMKKGVDPLHESQPIII
SIGPLSTIFPVVTKAVATFISPHTGEYGESHAGGRLAMAIRNAGYDAIVITGKAQKPTYL
VITDKNIEFKDARAMWGLDIEETGRVIREREPGPGKRSIIRIGKAGENLVTYSCVNVDTY
RHFGRLGIGAVFGSKNLKAMMIMGEEDLPIANLKEYFKTYQEIYKKVTQTDAMAKYHELG
TPMNIKVLNSISSLPTKNLLQSTFEHADDISGETFAEKNLVRKVSCVGCPIGCIHIGQFR
REFDKGYEYESISVSYDHELIYALGSLLGIKTTDEVLQIIEEVELAGLDAITTGVVLAWA
TEALKKGLISREDTLADLEFGNTMEYVKAIDNIAERVNEFYYTIGKGLKEAVKKYGGEEF
ALLYGGNEMAGYHTGYAFALGQTVGARHSHLDNAGYSYDQSAKELKDDEIINYVINEEKE
RAVLTSLCICLFARKVYDRPTILKALNAVGINWTDDDLTRLANDVFFTKLKIKKELGYSL
ENYKFPKRIFETPTMWGKMDEERLNRLLKMYIERVEKEYEDWSRGK
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgataggcaaagactttataagagtgctttatatagaccttacaaacaaaaaagcagac
attcaagaaaggaaggatctttataaatacttaggcggagcaggtgttgcagcaaagctt
ttagaggaaaatatgaaaaaaggtgttgaccctttgcatgaaagccagccgatcatcatt
tcaatcgggcctctttcaacaatctttcctgttgtgacaaaagctgtagcaacctttatt
tcacctcacacaggcgaatatggtgaaagccatgcaggtggaagacttgcaatggctata
agaaatgcaggatatgatgcaatagttataacaggaaaagctcaaaagcccacatacctt
gtcattacagataaaaatattgaatttaaagatgcaagagctatgtggggacttgacata
gaagagacaggaagggttataagagaaagagagccaggtccaggaaaaagaagtataatc
agaattggcaaggcaggggaaaaccttgtaacatactcttgtgtcaatgttgacacctac
aggcattttggaaggcttgggattggtgcggtctttggcagcaagaacctcaaagctatg
atgataatgggagaagaggacttgccaattgccaaccttaaagagtactttaagacttat
caggagatatacaaaaaagttacacagacagatgcgatggccaagtatcacgagcttgga
acacctatgaatatcaaagtgctaaatagcataagttctcttccaactaagaatttactt
cagtctacatttgagcatgcggacgatatctcaggtgagacatttgccgaaaagaacttg
gtcagaaaggtttcgtgtgtaggctgtcccattggatgcatccatataggacagttcaga
cgcgagtttgacaagggatatgagtatgagtccatttctgtctcatatgaccatgaactt
atatacgcacttggaagccttttggggataaagacaacagacgaggtattgcagattata
gaagaggttgaacttgcaggacttgatgctataacaacaggtgttgtattggcatgggca
acagaagcactcaaaaaagggcttatctcaagagaagacactcttgcagatcttgagttt
ggcaacaccatggagtatgttaaagcaattgataatattgcagaaagagtcaacgaattt
tactacacaattggcaaaggtttgaaagaagctgtgaaaaaatatggtggagaagaattt
gcacttttgtatggtgggaatgagatggcaggatatcatacaggctatgcatttgcgctt
ggtcaaacagttggtgcaaggcattctcatttagacaatgcaggttactcttatgaccag
agtgcaaaagaattaaaagatgatgaaataataaattatgtaattaatgaagaaaaagaa
agggcagtgctcacatcactatgcatatgtctgtttgcccgaaaggtgtatgacaggcca
accatcttgaaagcgttaaatgctgttggtataaactggacagacgatgacctcacacga
cttgcgaatgatgtatttttcacaaaactgaaaatcaaaaaagagcttggatattcactt
gaaaattataagtttccaaagagaatatttgaaacaccgacaatgtggggtaagatggat
gaagagaggttaaataggcttttgaaaatgtatatcgagagggtggaaaaggaatatgaa
gattggagtagaggtaaatag

DBGET integrated database retrieval system