KEGG   Caldicellulosiruptor lactoaceticus: Calla_1342Help
Entry
Calla_1342        CDS       T01600                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:clc00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:clc00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1413975..1415477)
Genome map
AA seq 500 aa AA seqDB search
MPTKKMQNRKGEDFLKLKDLIENIDVLETNVKDFDKDITDIAYNSKNAKEGCAFVCIKGF
KTDGHEYIDEAIKNGARLVVVDEFFDTSKIDGKIDYIKTSNTRKALAVMSANFFGHPSKD
FLLIGVTGTNGKTSTTFMIKSILEANSQKVGLIGTIKNMIGSKEIEAQHTTPESYDLQKL
FWQMKNEGVDSVVMEVSSHSLELYRVYDCDFDVGVFTNLTQDHLDFHGTMENYFAAKLKL
FEMSKKRVVNADDSWGKRIIEMYPDCVTYAKDSDAQVCTKNVKLFVNKNQFELWYNGKKE
EITLNIPGLFSIYNSLAAAACCISLGIELDTIKKGLEDLKAVPGRFEIVESNERFTIVID
YAHTPDGLLNLMKTVDDVAEGRKVLLFGCGGDRDRTKRPIMGEIAGRMADFVIVTSDNPR
TEDPLKIIADILEGIRKTNVEYVVIPDRYEAIKYAIKNAKENDFIVLAGKGHETYQILKD
RTIPFDERKIVKDILKELRE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
ttgccgacaaagaaaatgcagaatagaaagggtgaagacttcttgaaattaaaggatttg
attgagaatatcgacgttttggaaacaaatgttaaggattttgataaagacataactgat
attgcgtacaattcaaagaatgcaaaagaaggctgtgcttttgtgtgtataaaaggtttt
aagacagatggtcatgaatatatcgatgaagcaatcaaaaatggtgcacgtttagtggtt
gtggatgagttttttgacacatctaaaattgatgggaagattgattatatcaagacttca
aatacacgtaaagcccttgctgtgatgtctgcaaacttttttggtcatccatcaaaagac
tttttgcttattggtgtgacaggtacaaacggcaaaacttcaacaacatttatgataaag
tctatccttgaagcaaattcgcaaaaagtagggttgattggtacaatcaagaatatgata
ggtagcaaagaaattgaggctcagcatacaacgcctgagtcttatgacctacaaaagctc
ttttggcagatgaaaaacgagggtgttgacagtgttgtgatggaggtctcttcacactct
cttgagctttatcgtgtgtatgactgtgattttgacgttggagtttttacaaacctcact
caggatcatttagactttcatggaaccatggaaaattattttgctgcaaaactgaagctt
tttgagatgagcaaaaaaagggttgtaaatgccgacgatagctggggaaaaaggattatt
gaaatgtatcctgactgtgtaacatatgctaaagacagcgatgcccaggtttgtacaaaa
aatgttaaactttttgttaacaaaaatcaattcgagctgtggtacaatggcaaaaaagaa
gagataacacttaacatcccgggacttttttcaatttacaatagcctggctgctgcagca
tgttgtatttcgcttggcattgaacttgatacaataaaaaaaggtctagaagatttaaaa
gctgtgccaggcagatttgagatagttgagtcaaacgaaaggtttacaattgtgattgac
tatgcacacacacctgacgggcttttaaatcttatgaaaacagtagatgatgtggcagag
ggaagaaaagtattgctttttggatgcgggggggacagagacaggacaaaaagaccaatt
atgggtgagattgctggcaggatggcagattttgtgattgttacatctgataatccgcga
acagaagacccgctcaagattattgctgatatcttggaagggataagaaagacaaatgtt
gagtatgtggtcatacccgacaggtatgaggctattaaatatgccataaagaacgcaaag
gaaaatgattttattgtccttgccgggaaaggacatgaaacttaccagattttaaaagat
agaactataccgtttgatgagagaaaaatagttaaagatatcttaaaggagctaagagaa
tga

DBGET integrated database retrieval system