KEGG   Caldicellulosiruptor lactoaceticus: Calla_1358Help
Entry
Calla_1358        CDS       T01600                                 

Definition
protein recA
Orthology
K03553  
recombination protein RecA
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:clc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Calla_1358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1430073..1431143)
Genome map
AA seq 356 aa AA seqDB search
MENLDKKKALDKVIMEIEKAYGKGAIMKLGEMAKENIDVIPTGALSLDIALGVGGVPRGR
IVEIYGAESSGKTTIALHIIAEAQKMGGEAAFIDAEHALDPFYAKKLGVDINNLIVSQPD
SGEQALEIVEALVRSNAIDVIVIDSVAALVPQAEIDGEMGEAHVGLQARLMSQALRKLAG
ITSKTKTTVIFINQLREKVGVMFGNPETTPGGRALKFYASVRLEVRKGEIIKSQGQPIGS
KVKVKVVKNKVAPPFKEAEFDLIYGEGISKEGNVLDVAVNIDVIQKSGAWYTYNGQKIGQ
GRENAKQFLKENPDIMQEIIEKIRQNANLAFEKIKTTAEISDEDLLLSGEINEDIG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacttagataagaaaaaagccttagacaaggttattatggagattgagaaggct
tacgggaaaggcgctataatgaagcttggcgagatggcaaaggaaaatattgatgttata
cctacaggtgcgctttctttggacattgcgcttggcgttggaggagttccgcgaggaaga
attgtagagatatatggtgcagagtcatctggtaagaccaccattgcgcttcacataatt
gcagaggcacaaaaaatgggtggtgaggcagcatttattgacgctgagcatgcgcttgac
ccattttatgctaaaaagcttggtgttgacataaacaatcttattgtttcccagccggac
agtggcgagcaggctttggagattgtggaggcgcttgttagaagcaatgcgatagatgtt
attgtaattgactctgttgcggcgcttgtgcctcaggcagagattgatggtgagatggga
gaagcgcatgttggacttcaggcaaggctcatgtcacaggcgctcagaaagcttgcgggt
attacaagcaagacaaagaccacagtcatattcataaaccagcttcgtgaaaaggttggt
gtgatgtttggcaatccagagacaacaccgggtggtagagcactcaagttctatgcatct
gtcaggttagaagttagaaaaggtgagattatcaagtctcaaggccaaccgataggcagc
aaggtaaaggtcaaggttgtaaagaataaggttgcgccaccgtttaaagaggctgagttc
gatttgatttatggagaaggaatctcaaaagaaggaaatgttttagatgttgcagttaac
atcgatgttattcaaaagagtggggcgtggtatacttacaacggtcagaagattgggcag
ggcagagaaaacgcaaaacagtttttgaaagaaaatcctgatataatgcaggagataatt
gaaaagataaggcagaatgcaaaccttgcatttgagaagataaagacaacagcagagatt
tctgatgaggatttgctgttgagtggtgaaattaatgaggatattggataa

DBGET integrated database retrieval system