KEGG   Caldicellulosiruptor lactoaceticus: Calla_1563Help
Entry
Calla_1563        CDS       T01600                                 

Definition
glycoside hydrolase family protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:clc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Calla_1563
Enzymes [BR:clc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Calla_1563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1635396..1637435)
Genome map
AA seq 679 aa AA seqDB search
MGKIKLKKFLHGGDYNPDQWTEDVWEKDIEFMKYYNVNAVSMPIFSWAQLQPNEDEFTFE
WLDKIINKLYSNGIHVILATPTASQPAWLSKKYPDVLPVDIHGRKRKHGARQNYCPNSPN
FKNAARRIVEEMAKRYKDHPAVIMWHISNEYGPYCYCENCAKAFREWLKERYKTLDELNK
RWNTAFWGHTFYDWDEIEVPSYLNEEYEYMPGRQKSSFQGLSLDYKRFMSDSLLNLYKME
VEIIKKYMPDIPVTTNLMGPFKPLDYHKWAKHMDIVSWDNYPSIKDAPSTIAFKHDLMRG
LKRDQSFILMEQTPSQTNWQWYNSAKRPGMIRLLSYHAIAHGADSVLYFQWRQSIASCEK
FHSAMVPHVGHLETRVSKELKKIGDELLRLDEILESTTKSEVALLFDWENWWALEESMGF
RNDISYLEHIDAYYRALYNLKTNVDVVDPKEDLTRYKIVVAPLLYLLDEEGANNIENYVK
NGGIFITTYLSGLVDENDRVILGGYPGWFRKLCGIWVEEIDALFPDMKNAIILEKPIGML
DGKYECDFICDVIHLEGARALAYYEQDYYSGMPAVVENDYGNGKAIYIGTRPEQRFIEGL
VKFYAEKAGVQPILPVPEGVEITKREKNGNEYVFLLNFNNYDVNIELEDEYYELITQKVL
SGKATLASKEVMVLRKLKG
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatcaagctaaaaaaatttttgcacggtggagactacaatcctgaccagtgg
acagaggatgtgtgggaaaaagacattgaatttatgaaatactataatgtgaatgcagtt
tctatgccaatattttcatgggcacagcttcagccaaatgaagatgaatttacatttgaa
tggcttgataaaataatcaataagctctattcaaatggaattcatgtcatcttggcaaca
cctacagcttctcagccagcatggctctcgaaaaagtatcctgatgtgcttcctgttgat
attcatggaagaaagagaaaacatggagcaaggcagaactactgtcctaacagtccaaac
ttcaaaaatgcagcaagaagaattgttgaggagatggcaaaaaggtataaagaccatcct
gcagttataatgtggcatatcagtaacgaatatggtccttactgctactgtgaaaactgt
gcaaaagcctttagagagtggctaaaagaaagatataaaacattggatgagcttaacaag
agatggaacacagctttctggggacacacattctatgattgggatgaaatagaggttccg
tcatatctgaacgaagaatatgaatatatgcctggaaggcagaaaagctcattccaggga
ctttcacttgattacaagagatttatgtcggatagccttctaaatctttataaaatggaa
gttgagattatcaaaaaatacatgccagatatccctgttacaacaaacttgatgggacca
ttcaagcctcttgactatcacaaatgggcaaaacatatggacattgtatcatgggacaat
tacccctcgataaaagatgctccatcaacaattgccttcaaacatgaccttatgagaggg
ctcaaaagagaccagtctttcatattaatggaacagacaccaagccagacaaactggcag
tggtacaactctgcaaaaagacctggtatgataaggcttttgagctatcatgcaattgca
cacggagctgattctgtgctgtatttccaatggagacagtcgattgcttcgtgcgaaaag
tttcactctgcgatggttccgcatgttggacaccttgagacgagagtgagcaaggagctt
aaaaagattggcgacgaacttttgcgcttagatgagattttggagtcaacaacaaagagc
gaggttgcacttttatttgactgggaaaactggtgggcgcttgaagagagtatgggattt
agaaatgatatatcttaccttgagcatatcgatgcgtactatagagcactatataatcta
aaaacaaatgtggatgttgttgacccaaaagaggatttaacaaggtacaagattgttgtt
gcaccacttttgtatcttcttgacgaagaaggtgcaaataacatagaaaattatgtaaaa
aacggtggaatatttattacaacatatttatcaggtcttgtagatgaaaatgacagagta
attcttggtggctatcctggatggtttagaaagctttgtggtatttgggttgaggagatt
gatgcgctttttcctgatatgaaaaatgcaattatacttgaaaaacctattggcatgctt
gatggcaaatacgaatgtgattttatctgtgacgttattcaccttgaaggtgcaagggcg
cttgcttactatgaacaggattattacagcgggatgccagcagttgttgaaaatgattat
ggaaatggaaaggcaatttatattggaacaagaccagagcaaaggtttatagaaggcctt
gttaaattctacgctgaaaaggctggtgtacaaccaatattacctgtaccagaaggtgtt
gaaataacaaaaagagaaaagaatggtaatgaatatgtgtttcttttgaatttcaataat
tatgatgtaaatattgagcttgaagatgagtattatgagcttataacacagaaggtttta
agcggaaaagctactcttgcatccaaagaggttatggtactaagaaagttgaaaggttaa

DBGET integrated database retrieval system