KEGG   Caldicellulosiruptor lactoaceticus: Calla_1721Help
Entry
Calla_1721        CDS       T01600                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
clc00010  Glycolysis / Gluconeogenesis
clc00020  Citrate cycle (TCA cycle)
clc00620  Pyruvate metabolism
clc00633  Nitrotoluene degradation
clc00640  Propanoate metabolism
clc00650  Butanoate metabolism
clc00680  Methane metabolism
clc01100  Metabolic pathways
clc01120  Microbial metabolism in diverse environments
clc01130  Biosynthesis of antibiotics
clc01200  Carbon metabolism
Module
clc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:clc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calla_1721
   00020 Citrate cycle (TCA cycle)
    Calla_1721
   00620 Pyruvate metabolism
    Calla_1721
   00640 Propanoate metabolism
    Calla_1721
   00650 Butanoate metabolism
    Calla_1721
  Energy metabolism
   00680 Methane metabolism
    Calla_1721
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Calla_1721
Enzymes [BR:clc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Calla_1721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_2 Fer4_7 Fer4_10 Fer4_16 Fer4_9 Fer4_4 Fer4_13 Fer4_15 Fer4_3 Fer4_17
Motif
Other DBs
NCBI-ProteinID: AEM74310
JGI: Calla_1721
UniProt: G2PTM9
Position
complement(1805622..1805924)
Genome map
AA seq 100 aa AA seqDB search
MMRKMKITEDVTWKEITPAGVIIDPGNAEDFKTGDWRTMRPVWHEDKCKQCLFCFYVCPD
SSIKVENGKMVGVDYDHCKGCGVCTEVCPFKAFDFVEEKK
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgatgagaaagatgaaaataacagaagatgttacatggaaggaaataacaccagcaggt
gtaattattgacccgggtaatgcagaggactttaaaacaggcgactggagaacaatgaga
cctgtatggcatgaagataagtgcaagcagtgtctgttctgcttctatgtatgtccagat
tcatcaataaaggtcgaaaatgggaagatggtaggagttgactatgaccactgcaaaggt
tgcggggtttgcacagaggtttgtccatttaaagcttttgattttgtagaggagaagaaa
taa

DBGET integrated database retrieval system