KEGG   Caldicellulosiruptor lactoaceticus: Calla_1743Help
Entry
Calla_1743        CDS       T01600                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:clc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Calla_1743
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Calla_1743
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Calla_1743
Enzymes [BR:clc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Calla_1743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1827583..1829064)
Genome map
AA seq 493 aa AA seqDB search
MRYISTRGSKEVQAKEAIYRGIAEDGGLYTPVSIPSLDIGEIKNIDSYANLAKYIFELYL
TDFTKEEIADCIDRAYSRGRFDTKDIVGIKKLSPGLFALELWHGPTYAFKDVALQVLPYL
LLKSMPSFYKQALILVATSGDTGKAALEGFKDVERTKIVVFYPSEGVSDVQKRQMTTQEG
RNTFVAGIKGNFDDAQSGVKEIFTSKKCIDTIENLGFFFTSANSINFGRLLPQIVYYIWS
YLVLLKAGDISEDEKINFVVPTGNFGNILAGFIAKLMGIPINKLIVASNINSVVADFVRT
GLYDRRRKFYKTISPSMDILVASNLERLLYLVTRDSERVKRYMLDLKTEGYFKVEEEVLK
EIQESFWGDFSTDDQTRNSIKTIYREYGYLVDPHSAVGFDVYTKYQKQTSDNTKTVVLQT
ANPYKFAKDVLNALFDGEYNNIDPFEALEILYAKTGVEVPEGIKSLLSKPILHPDVIEKD
KMFDFILEKIRDN
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcgatatataagcacaagagggagcaaagaggtgcaggcaaaagaagctatttacagg
ggaatagctgaagatggtgggctttacacacctgtttcaattccatctcttgacatagga
gagataaaaaacatagactcttacgcaaatcttgcaaaatatatatttgagctttacctt
acagattttacaaaagaagagattgctgattgcattgacagggcatatagccgtggcagg
tttgacacaaaagatattgtgggtatcaaaaagctcagtcctggtctttttgcacttgag
ctgtggcacggtccgacgtacgcttttaaagacgttgcgttgcaggttctaccttatctt
ttgctaaaatcaatgccgagtttttacaaacaggcgctaatacttgttgcaacatcaggc
gatactggcaaagctgccttggaagggtttaaggatgtggagagaacaaagatagttgtg
ttttatccatctgagggtgtgtcagatgttcagaaaagacagatgacaacccaggaaggc
agaaacacttttgttgccgggataaaaggcaattttgatgatgcccaatctggtgtgaag
gagattttcacaagcaaaaaatgcatagatacaatcgaaaatctggggtttttctttacc
tccgcaaactcaataaattttggtaggcttcttccacagattgtatactatatctggagt
tatctggtgcttttaaaggctggagatatatctgaagatgaaaagataaactttgttgtt
ccgacgggcaattttggcaatatattggcaggttttatcgcaaaacttatgggaattcct
ataaataagctgattgttgcttcgaacataaacagtgtggttgcagattttgtcaggaca
ggcttatatgacagaagaagaaagttttacaaaacaatctcaccttcaatggatattctt
gttgcaagtaatttggaaaggttattgtatttggtaacaagagattcagaaagagtaaaa
agatacatgttagatttgaaaactgaggggtatttcaaagttgaggaagaagttttaaaa
gagattcaggaaagtttctggggcgatttttccacagatgaccagacaagaaatagcata
aaaactatttaccgcgaatatggttatcttgttgacccgcactctgctgttgggtttgat
gtttacaccaagtaccaaaagcagacctctgataacacaaaaacggttgtacttcagact
gcaaatccttacaagtttgcaaaagatgttttgaacgctttgtttgatggtgaatataat
aatattgacccgtttgaagcactagagattttgtatgcaaagacaggtgttgaggtcccg
gaggggattaaaagtcttctttcaaagccaattttgcatcctgatgtgatagaaaaagac
aagatgtttgattttatattagagaaaataagagataattaa

DBGET integrated database retrieval system