KEGG   Caldicellulosiruptor lactoaceticus: Calla_1822Help
Entry
Calla_1822        CDS       T01600                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:clc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Calla_1822
  Lipid metabolism
   00561 Glycerolipid metabolism
    Calla_1822
   00600 Sphingolipid metabolism
    Calla_1822
Enzymes [BR:clc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Calla_1822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1912488..1913882)
Genome map
AA seq 464 aa AA seqDB search
MLNTTSEQQKQINIAYIGGGSRGWAWRLMTDLALEKDLGGTVRLYDIDFEAAKTNEVIGN
KLSSKPEVVGKWQYVAVGSLDEALYGADFVIISILPGTFEEMYSDVHAPEKYGIYQSVGD
TTGPCGLIRGLRTVPMYVEFAEAIKRNCPDAWVINYTNPMAICLKALYEVFPKIKAFGCC
HEVFGTQKLLTEVVKEFLGEEREISRREIKVNVLGINHFTWFDKASYKTHDLFPLYKEFV
NKYYEEGFEKTKGLWEKDYFASANRVKFDLFKRFGLIAAAGDRHLAEFVPYIYLTDKETV
YKWKFNLTPVEWRIKHREELIKLSKEYASDQKEVPLNPSGEEGVMQMKAILGLDTLVINV
NLPNMGQIPNLPIGAIVETNAVFTHDDVRPVYAGKLPSDLASIMTRHISNQELIVKAALE
KDLSLAKRAFLNDPAVERLPQNKAEQLFEEMINNTKKYLAYLNL
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttgaataccacatcagaacaacaaaaacaaatcaatatagcatacattggtgggggt
tcacgcggctgggcatggaggttgatgactgatttagctttagagaaggacctgggtggt
actgtgagactttacgacattgactttgaagctgccaagaccaacgaagtaataggaaat
aaactatcaagcaaacctgaagtagtagggaaatggcaatatgttgctgtagggagttta
gatgaagctttatatggagcagattttgttatcatttcaattttgcctgggacttttgaa
gagatgtattcagatgtccatgctcctgagaaatatggtatataccaatctgtaggagac
acaacaggaccatgtggtcttatcagaggacttaggactgttcctatgtatgttgaattt
gcagaagctataaagagaaattgtccagatgcttgggttatcaattacacaaatccaatg
gctatatgcttaaaagccctatatgaggtatttcctaaaataaaagcttttggctgctgt
catgaagtttttggtacacaaaagcttttgacagaggttgtaaaagaatttttaggagaa
gaaagagaaatctcaagaagagaaatcaaggtgaatgttcttggtataaatcattttacg
tggtttgacaaagcatcatacaaaactcacgatttattccctctttacaaagaattcgtg
aacaaatactatgaagaaggttttgaaaaaacaaaaggcttgtgggaaaaagattatttt
gcttctgcaaatagagtaaagtttgacttatttaaacgctttggacttattgctgcagca
ggtgatagacacttggctgaatttgttccttacatttatcttacagacaaagagacagtt
tataaatggaaattcaacttaacacctgtcgaatggcgaattaaacacagagaagaattg
attaaacttagcaaagaatatgcatctgaccaaaaagaagttccattgaatccttctgga
gaagaaggagtcatgcagatgaaagctattttaggtttggatacgttggtgataaacgtg
aatttgccaaatatgggtcaaataccaaaccttccgataggtgctatagttgagacaaat
gcagtattcacacatgatgacgtcagaccagtttatgcaggaaagctgccttcagattta
gcaagcataatgacaagacatatcagcaatcaagagcttatagttaaagctgctttagaa
aaggacttaagccttgcaaaaagagcattcttaaatgaccctgcagttgagagactaccg
cagaacaaagctgagcagctttttgaagagatgataaataacactaaaaagtatctggca
tatttaaacttgtaa

DBGET integrated database retrieval system