KEGG   Caldicellulosiruptor lactoaceticus: Calla_1871Help
Entry
Calla_1871        CDS       T01600                                 

Definition
3-isopropylmalate dehydratase small subunit
Orthology
K01704  
3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC:4.2.1.33 4.2.1.35]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
Valine, leucine and isoleucine biosynthesis
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:clc01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:clc01230]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:clc00660]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:clc00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1963845..1964345)
Genome map
AA seq 166 aa AA seqDB search
MIFKGKAHKYYDNIDTDVIIPARYLNTSDPAELAKHCLEDLDKEFVNKVQKGDILVAGKN
FGCGSSREHAPIAIKACGVSCVIAKSFARIFYRNAINIGLPIVECEEAVDGIEAGDEVEV
DLVTGSIKNLTKNKEFKAKPFPEFMQNIMKAGGLIEFVKGELKKDA
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgattttcaaaggaaaagctcacaagtattatgataacattgacacagatgttattatt
cctgcaagatatcttaacacatctgacccggctgaacttgcaaaacactgtttggaggat
ttggacaaagagtttgtgaacaaggttcaaaaaggtgacattttggttgcaggtaagaac
tttggctgtggttcgtcaagagagcatgcgccaattgcaataaaagcatgtggagtatct
tgtgttattgcaaagtcgtttgcaaggatattttacagaaatgctataaatattggtctt
ccaattgttgagtgcgaagaggcagtagatggaatagaagctggtgatgaggttgaagtt
gaccttgtaacaggtagcataaaaaatctcacaaagaacaaagagttcaaggcaaaaccg
tttcctgagttcatgcaaaatatcatgaaagcaggcgggcttatagagtttgtaaaagga
gagttgaaaaaagatgcatag

DBGET integrated database retrieval system