KEGG   Caldicellulosiruptor lactoaceticus: Calla_1871Help
Entry
Calla_1871        CDS       T01600                                 

Definition
3-isopropylmalate dehydratase small subunit
Orthology
K01704  
3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC:4.2.1.33 4.2.1.35]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
Valine, leucine and isoleucine biosynthesis
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:clc00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Calla_1871
   01230 Biosynthesis of amino acids
    Calla_1871
  Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    Calla_1871
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Calla_1871
Enzymes [BR:clc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     Calla_1871
    4.2.1.35  (R)-2-methylmalate dehydratase
     Calla_1871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1963845..1964345)
Genome map
AA seq 166 aa AA seqDB search
MIFKGKAHKYYDNIDTDVIIPARYLNTSDPAELAKHCLEDLDKEFVNKVQKGDILVAGKN
FGCGSSREHAPIAIKACGVSCVIAKSFARIFYRNAINIGLPIVECEEAVDGIEAGDEVEV
DLVTGSIKNLTKNKEFKAKPFPEFMQNIMKAGGLIEFVKGELKKDA
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgattttcaaaggaaaagctcacaagtattatgataacattgacacagatgttattatt
cctgcaagatatcttaacacatctgacccggctgaacttgcaaaacactgtttggaggat
ttggacaaagagtttgtgaacaaggttcaaaaaggtgacattttggttgcaggtaagaac
tttggctgtggttcgtcaagagagcatgcgccaattgcaataaaagcatgtggagtatct
tgtgttattgcaaagtcgtttgcaaggatattttacagaaatgctataaatattggtctt
ccaattgttgagtgcgaagaggcagtagatggaatagaagctggtgatgaggttgaagtt
gaccttgtaacaggtagcataaaaaatctcacaaagaacaaagagttcaaggcaaaaccg
tttcctgagttcatgcaaaatatcatgaaagcaggcgggcttatagagtttgtaaaagga
gagttgaaaaaagatgcatag

DBGET integrated database retrieval system