KEGG   Caldicellulosiruptor lactoaceticus: Calla_2360Help
Entry
Calla_2360        CDS       T01600                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:clc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Calla_2360
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Calla_2360
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Calla_2360
Enzymes [BR:clc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Calla_2360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2511205..2512560)
Genome map
AA seq 451 aa AA seqDB search
MREEFYKVFLAEDEIPKSWYNITADLKTPLDPPLDPSTKELIDPNKLKAIFPEELIKQEM
ATNAFVPIPEEVLEFYKQYRPTPLIRAKRLEKILDTPAKIFYKYEGATPSGSHKLNTAIP
QAYYNKREGIKRLATETGAGQWGSALAIACSFFGLDCTVYMVKVSYNQKPYRRILMETFG
AKVIPSPSEFTEAGRRILAQDPNSPGSLGIAISEAVEDAATHSDTNYALGSVLNHVILHQ
TIIGEEAKLQMEKIDEYPDIVIGCCGGGSNFAGISFPFLRDKLRNGKNVRAIAVEPAACP
TLTKGQFAYDYGDVAGLTPLLKMYTVGSQFIPPSIHAGGLRYHGDSPIVSRLYKDGIIEA
RAYKQREVFEAAILFAKSEGIIPAPESSHAIKAAIDEAIKAREEGVKKTILISLSGHGHF
DLAAYENYLSGRLEDVEISDEDIEKSLSKLP
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagagttttacaaagtctttttagctgaggacgagatacccaagagttggtac
aacatcactgctgatttaaaaactccacttgacccgccgcttgacccatcaacaaaagag
ttgattgacccaaataaactcaaagcaatttttcctgaagagctaataaagcaagagatg
gcaaccaatgcatttgtgccaattccagaggaagtgttagagttttataagcaatacaga
ccaactcctctaatcagagcaaagcgcttagaaaaaattcttgatactcctgccaaaata
ttctataagtatgaaggtgcaactccctctggaagccacaagctaaatactgctatacct
caagcgtactataataaaagagagggaataaaaaggcttgcaacagagacaggtgcgggc
cagtgggggtctgctttggcaattgcctgcagcttttttggacttgattgcacagtctac
atggtaaaggtgagctacaatcaaaagccttacagaaggatattaatggaaacatttgga
gcaaaggtaatcccaagtccaagtgagtttacagaggctgggagaagaattcttgcacag
gacccgaactcacccggaagccttggcattgcgattagcgaggcagtggaagatgctgcg
actcattcagacacaaactatgcacttggaagtgttttaaatcatgttattttgcatcaa
accataataggagaagaagcaaagcttcaaatggagaagatagatgaatatcccgacata
gttataggatgctgcggtggtggcagcaactttgcaggaattagctttcctttcttgagg
gataaactaagaaatggaaagaatgtaagggctatagcagttgaacctgcggcatgtccg
actttaacaaagggacaatttgcctatgactatggagatgttgcaggactcacacctctt
cttaagatgtacacggtaggaagccagttcattccgccaagtattcatgcaggtgggctg
cgatatcacggtgattcgccgattgtcagcagactttataaggatggaataattgaggca
agagcgtataaacaaagagaagtttttgaagcagctattttattcgcaaaatcagaaggc
attattccagcacccgagtcttcccatgctatcaaagctgcaatagatgaagcaatcaag
gcacgtgaagaaggtgtcaaaaagacaattttaatatcactgagcggtcatggtcatttt
gacttggctgcatatgaaaattacctcagcggcaggcttgaggatgttgagatttctgat
gaagacattgaaaagtcattgagcaaattgccataa

DBGET integrated database retrieval system