KEGG   Caldicellulosiruptor lactoaceticus: Calla_2430Help
Entry
Calla_2430        CDS       T01600                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
clc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:clc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Calla_2430
Enzymes [BR:clc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Calla_2430
DNA repair and recombination proteins [BR:clc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Calla_2430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 Viral_helicase1 AAA_11 HHH_5 PIF1 Helicase_RecD UvrD_C T2SSE AAA_24 DEAD ATPase_2 AAA_12 AAA UvrD-helicase DUF2075 HHH_2 AAA_22 NTPase_1 DUF853 PhoH SRP54 ABC_tran AAA_29 ArgK AAA_23 TrwB_AAD_bind ABC_ATPase AAA_10 AAA_16 Thymidylate_kin RsgA_GTPase Mg_chelatase AAA_25 DUF1779 MobB AAA_28
Motif
Other DBs
NCBI-ProteinID: AEM74956
JGI: Calla_2430
UniProt: G2PYN7
Position
complement(2605561..2607774)
Genome map
AA seq 737 aa AA seqDB search
MQQNIQGMVSDIIYRNLENSYTVFEIICDDEVFTAVGIVPDIAIGEKVSVYGEFYVHPVY
GQQLKVSYLEKLLPQTKDEIYLYLSSGVIKGIGQKTAKKIVDTFGEDTARVLQEEPEKLL
QIRGMTPEKVERIRNMFAFQKFLKDIMSIFSQYGLSQNHAMRLFKLYGFSALSLLQENPY
FLLDVFPELDFKKVDRLALDMGVMPDDRRRISAKILNLLTLAANNEGHTCLPENRLKQLC
SKTLDLPVEKIEEALEALEVERRVVKDEVDSQEMVFLYGYYECERYIADKILSMLKEYDD
IADIDEKISMFEERNGIVFSPNQKKAIKMALTQGVSIITGGPGTGKTTIIKCIIQIFESE
GKKVFLCAPTGRAAKRMQAACERESKTIHRLLEMTVLDTHVIFQKGPSNPLKCDVIIVDE
MSMVDSFLMNYLLAATKPSTRIVLVGDKDQLPSVGAGNVLKDLIKSEIVPCTTLTEVYRQ
SENSFIVLNAHRINRGEFPHLQKESDFYFIQKNSQEEILKTVVELVTKKLPNYLSCDPMT
DIQVLCPSKKGIVGMYNLNRVLQQHLNPPHPSKKEYVYKENLFRVGDKVMQIKNNYSLEY
EIVQGEEKGRGWAGIFNGDIGVVKDIDRAQGALEILFDDEKLVYYDFSLLDDLELAYAMT
VHKSQGSEFRCIVMPVVETYPILMTRNLLYTAVTRAKELVVLVGKKSALEYMIANQKEAM
RYSGLYDFLKKKIDVVT
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaaaacattcaaggaatggtgagcgatataatctacaggaacttggagaatagc
tatacggtgtttgagataatctgcgacgatgaggtgttcacagcagtaggaatagttcca
gacattgccatcggcgaaaaggtgagcgtttacggtgagttttatgttcatcctgtttac
ggtcagcagctgaaagtaagctaccttgaaaagcttttgccacagacaaaggatgagata
tatctttatctttcctctggagtgataaaaggtatcgggcagaagactgcaaagaagatt
gttgatacctttggggaagacactgcaagagttctgcaagaagagcctgaaaagcttttg
cagattcgcggcatgacaccagaaaaggttgagcgaataagaaacatgtttgcgttccag
aaatttttgaaagacatcatgtcaatcttttcccagtacggactttcacagaaccatgca
atgagactttttaaactttatggattttctgctctgtcgcttttgcaggaaaatccatat
tttcttttggacgtgttcccagagcttgactttaaaaaggttgacaggcttgcacttgac
atgggagttatgccggatgacagaagaagaatatctgctaaaatactcaacctcttaact
ctggctgcaaacaacgaggggcacacctgcctgccagaaaataggctcaaacagctttgt
tcaaaaacccttgaccttccagtggaaaaaatagaagaggcacttgaagctttagaggta
gaaagaagagttgtgaaagatgaagttgactctcaagaaatggtgtttttgtacggctac
tatgaatgcgaaaggtatatagcagataaaatcctgtcaatgctaaaagagtatgatgac
attgccgatatagatgaaaaaatttcaatgtttgaagagagaaacggcattgtattttca
ccaaatcagaaaaaagccatcaagatggcgctaactcaaggtgttagcatcatcacaggc
ggaccgggaactggtaagaccacaatcataaagtgcataattcagattttcgagagtgaa
ggcaaaaaggtttttctctgcgcaccaaccggaagagctgcaaagaggatgcaggcagcc
tgcgaaagagaatcaaagacaatccacaggcttttggaaatgacagttttggacacacat
gttattttccagaaaggaccaagcaatcctttaaaatgcgatgtcatcattgttgatgag
atgagcatggtagacagtttccttatgaactatcttcttgctgcaacaaagccgtcaacc
agaattgtgcttgttggagacaaagaccagcttccatctgttggtgcagggaatgtctta
aaagacctaataaaaagcgaaattgttccctgtactactttgacagaggtgtaccgccag
agcgaaaatagttttatagtcctcaacgctcacagaataaaccgaggagagtttccgcac
cttcaaaaagagagcgatttttattttatccagaaaaactctcaggaagagattttaaaa
actgtggttgaacttgtgaccaaaaaacttccaaactatctttcgtgcgacccgatgaca
gacatccaggtcctgtgcccttctaaaaaggggattgttgggatgtacaacctaaaccgc
gtgctgcagcagcatctcaacccacctcatccatctaaaaaagagtatgtttataaagaa
aacctgttcagggttggagacaaggtcatgcagataaaaaacaactattcgctggaatat
gagattgtacaaggagaggagaagggcaggggctgggcagggatattcaatggcgatatc
ggagttgtcaaagacatcgacagggcgcaaggtgcgctggagattttgtttgacgatgaa
aagcttgtgtattatgacttttcgctgcttgacgacttagagcttgcatatgccatgact
gttcacaagtcgcaagggtctgaattcaggtgcatagtgatgcctgttgttgagacctac
cctattttgatgacaagaaaccttctgtatacggcagttacgcgtgcaaaagagcttgtt
gtgctggtgggcaaaaaaagtgctttagagtacatgattgcaaaccaaaaagaggctatg
cgatattcaggactttatgattttctgaagaagaagatagacgttgtaacgtga

DBGET integrated database retrieval system