KEGG   Caldicellulosiruptor lactoaceticus: Calla_2430Help
Entry
Calla_2430        CDS       T01600                                 

Definition
helicase, RecD/TraA family
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:clc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Calla_2430
Enzymes [BR:clc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Calla_2430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2605561..2607774)
Genome map
AA seq 737 aa AA seqDB search
MQQNIQGMVSDIIYRNLENSYTVFEIICDDEVFTAVGIVPDIAIGEKVSVYGEFYVHPVY
GQQLKVSYLEKLLPQTKDEIYLYLSSGVIKGIGQKTAKKIVDTFGEDTARVLQEEPEKLL
QIRGMTPEKVERIRNMFAFQKFLKDIMSIFSQYGLSQNHAMRLFKLYGFSALSLLQENPY
FLLDVFPELDFKKVDRLALDMGVMPDDRRRISAKILNLLTLAANNEGHTCLPENRLKQLC
SKTLDLPVEKIEEALEALEVERRVVKDEVDSQEMVFLYGYYECERYIADKILSMLKEYDD
IADIDEKISMFEERNGIVFSPNQKKAIKMALTQGVSIITGGPGTGKTTIIKCIIQIFESE
GKKVFLCAPTGRAAKRMQAACERESKTIHRLLEMTVLDTHVIFQKGPSNPLKCDVIIVDE
MSMVDSFLMNYLLAATKPSTRIVLVGDKDQLPSVGAGNVLKDLIKSEIVPCTTLTEVYRQ
SENSFIVLNAHRINRGEFPHLQKESDFYFIQKNSQEEILKTVVELVTKKLPNYLSCDPMT
DIQVLCPSKKGIVGMYNLNRVLQQHLNPPHPSKKEYVYKENLFRVGDKVMQIKNNYSLEY
EIVQGEEKGRGWAGIFNGDIGVVKDIDRAQGALEILFDDEKLVYYDFSLLDDLELAYAMT
VHKSQGSEFRCIVMPVVETYPILMTRNLLYTAVTRAKELVVLVGKKSALEYMIANQKEAM
RYSGLYDFLKKKIDVVT
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaaaacattcaaggaatggtgagcgatataatctacaggaacttggagaatagc
tatacggtgtttgagataatctgcgacgatgaggtgttcacagcagtaggaatagttcca
gacattgccatcggcgaaaaggtgagcgtttacggtgagttttatgttcatcctgtttac
ggtcagcagctgaaagtaagctaccttgaaaagcttttgccacagacaaaggatgagata
tatctttatctttcctctggagtgataaaaggtatcgggcagaagactgcaaagaagatt
gttgatacctttggggaagacactgcaagagttctgcaagaagagcctgaaaagcttttg
cagattcgcggcatgacaccagaaaaggttgagcgaataagaaacatgtttgcgttccag
aaatttttgaaagacatcatgtcaatcttttcccagtacggactttcacagaaccatgca
atgagactttttaaactttatggattttctgctctgtcgcttttgcaggaaaatccatat
tttcttttggacgtgttcccagagcttgactttaaaaaggttgacaggcttgcacttgac
atgggagttatgccggatgacagaagaagaatatctgctaaaatactcaacctcttaact
ctggctgcaaacaacgaggggcacacctgcctgccagaaaataggctcaaacagctttgt
tcaaaaacccttgaccttccagtggaaaaaatagaagaggcacttgaagctttagaggta
gaaagaagagttgtgaaagatgaagttgactctcaagaaatggtgtttttgtacggctac
tatgaatgcgaaaggtatatagcagataaaatcctgtcaatgctaaaagagtatgatgac
attgccgatatagatgaaaaaatttcaatgtttgaagagagaaacggcattgtattttca
ccaaatcagaaaaaagccatcaagatggcgctaactcaaggtgttagcatcatcacaggc
ggaccgggaactggtaagaccacaatcataaagtgcataattcagattttcgagagtgaa
ggcaaaaaggtttttctctgcgcaccaaccggaagagctgcaaagaggatgcaggcagcc
tgcgaaagagaatcaaagacaatccacaggcttttggaaatgacagttttggacacacat
gttattttccagaaaggaccaagcaatcctttaaaatgcgatgtcatcattgttgatgag
atgagcatggtagacagtttccttatgaactatcttcttgctgcaacaaagccgtcaacc
agaattgtgcttgttggagacaaagaccagcttccatctgttggtgcagggaatgtctta
aaagacctaataaaaagcgaaattgttccctgtactactttgacagaggtgtaccgccag
agcgaaaatagttttatagtcctcaacgctcacagaataaaccgaggagagtttccgcac
cttcaaaaagagagcgatttttattttatccagaaaaactctcaggaagagattttaaaa
actgtggttgaacttgtgaccaaaaaacttccaaactatctttcgtgcgacccgatgaca
gacatccaggtcctgtgcccttctaaaaaggggattgttgggatgtacaacctaaaccgc
gtgctgcagcagcatctcaacccacctcatccatctaaaaaagagtatgtttataaagaa
aacctgttcagggttggagacaaggtcatgcagataaaaaacaactattcgctggaatat
gagattgtacaaggagaggagaagggcaggggctgggcagggatattcaatggcgatatc
ggagttgtcaaagacatcgacagggcgcaaggtgcgctggagattttgtttgacgatgaa
aagcttgtgtattatgacttttcgctgcttgacgacttagagcttgcatatgccatgact
gttcacaagtcgcaagggtctgaattcaggtgcatagtgatgcctgttgttgagacctac
cctattttgatgacaagaaaccttctgtatacggcagttacgcgtgcaaaagagcttgtt
gtgctggtgggcaaaaaaagtgctttagagtacatgattgcaaaccaaaaagaggctatg
cgatattcaggactttatgattttctgaagaagaagatagacgttgtaacgtga

DBGET integrated database retrieval system