KEGG   Cellulosilyticum lentocellum: Clole_0026Help
Entry
Clole_0026        CDS       T01448                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
cle  Cellulosilyticum lentocellum
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Clole_0026
   00051 Fructose and mannose metabolism
    Clole_0026
Enzymes [BR:cle01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Clole_0026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
32524..33846
Genome map
AA seq 440 aa AA seqDB search
MAEFFKGIGVIPFEGADSVNPLAFKHYNKDEKVGDKTMAEHLRFAMSYWHTLCAEGGDPF
GSTTAARPWNQIANPIEMAKAKVDAGFEFMQKLGIEYFCFHDRDIAPEGKDLAETNQILD
EVVAYIKVKMQETGIKLLWGTANCFNNKRFMHGAGTTCNAEVFAYAAAQIKKAIEVTKEL
GGENYVFWGGREGYETLLNTDTGLELDNFARLLQMAVDYAKEIGFTGQFLIEPKPKEPTK
HQYDFDTATVLAFLRKYNLDTYFKMNIEANHATLAGHTFQHELNMSRINNVLGSIDANQG
DLMLGWDTDQFPTNIYDATMAMYEVLKAGGIAPGGFNFDSKVRRGSFEEADLFIAYIAGM
DTFAKGLKVAYNLLKDGVLEDFVADRYASFNEGIGKDIVSGNVGFKELEAYALKQQPIVN
KSGRQEWLETVVNQYIYNNK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcagaattttttaaaggaattggggtaatcccatttgaaggggcagattcagtaaac
ccacttgcattcaaacattataacaaagacgaaaaagtaggtgataagacaatggcagaa
catttacgttttgcaatgtcttactggcacacactttgtgctgaaggtggagatccattt
ggttctactacagcagctagaccttggaaccaaatagctaatcctattgaaatggcaaaa
gctaaagtagatgctggctttgaatttatgcaaaaattagggattgaatatttctgtttc
catgatagagatattgcaccagaaggtaaagaccttgctgaaactaatcaaattcttgat
gaagtagtagcttacatcaaagttaaaatgcaagaaacaggcattaaacttctttgggga
acagctaactgctttaataacaaacgtttcatgcatggtgcaggaacaacttgcaatgca
gaagtatttgcttatgcggcagctcaaattaagaaagcaatcgaagtaacaaaagaatta
ggaggagaaaactatgtattctggggtggtagagaaggttatgaaacactcttaaacaca
gatacaggtcttgaacttgacaactttgcaagacttttacaaatggcagtagattatgct
aaagaaattggtttcacaggacaattccttatcgagccaaaaccaaaagaacctacaaaa
catcaatacgactttgatacagcaaccgtacttgcattccttagaaaatacaacttagat
acatacttcaaaatgaatatcgaagctaaccatgctacacttgcagggcatactttccaa
catgaactcaatatgagccgaattaacaacgtattaggaagtattgatgcgaaccaggga
gaccttatgctagggtgggatacagaccaattcccaacaaatatctatgatgcaacaatg
gctatgtacgaagtgttaaaagcaggcggtattgcaccaggtggatttaactttgactca
aaagtaagaagaggctcatttgaagaagcggatttatttatcgcatatattgcgggtatg
gatacctttgcaaaaggtttaaaagtagcttataacttactaaaagatggcgtgttagaa
gattttgtagcagatcgttatgcaagctttaatgaaggtattggtaaagatattgtaagt
ggtaacgtaggttttaaagagttagaagcatatgcacttaaacaacaacctatcgttaat
aagtctggtagacaagaatggttagaaaccgtagttaaccaatatatctataacaataaa
taa

DBGET integrated database retrieval system