KEGG   Cellulosilyticum lentocellum: Clole_0212Help
Entry
Clole_0212        CDS       T01448                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
cle  Cellulosilyticum lentocellum
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Clole_0212
Enzymes [BR:cle01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Clole_0212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
279631..281082
Genome map
AA seq 483 aa AA seqDB search
MSIKNEIMLITYADSIGKDLKDLKFVLETYLKNIVGGVHILPFYPSSADRGFAPMEYYQV
DPKFGTWKEIEQISESYYTMYDFMINHISKSSVYFKDFLENKDESIYKDLFIKYSEFWTN
GYPTQEQIDLIYKRKPRAPYIDVEFKDGTKEKIWCTFDEEQIDLDISKKATKDFIKENLK
FMCENGAALIRLDAFAYATKKEGSNCFFIEPDTWEILEYCKNIVEEYGVALLPEIHEHYS
IQKKIAEKGYYVYDFALPMLVLHALYSGTNKRLINWFNTCPKKQFTTLDTHDGIGIVDVK
DLMTDEEIEQTKSNLYEQGANVKRKYSSTAYNNLDIYQVNCTYYSALGDNDAAYLLARAI
QFFAPGIPQVYYVGLFAGKNDIELLEKTKNGRDINRHYYTLEEIQQETQRDVVNKLFKLM
AFRNNYKAFDGEMIIHPTEYENKLKIEWINNEYRAVLEADLKQKSFNILYKDIAEAVFKQ
LEL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgagtataaaaaatgaaattatgctaattacctatgcagatagtataggtaaagacttg
aaagatttaaaattcgttctagagacatatctaaaaaatattgtagggggagtacatatt
ctacctttttatccttcttcagcagatagaggatttgcacctatggaatattatcaagta
gatcctaaatttggcacctggaaggagatagagcagattagtgagtcttattatacaatg
tatgactttatgattaatcatatctcgaaatcatctgtatattttaaggattttctagag
aataaagatgagtccatttataaggatttgtttattaagtatagtgagttctggaccaat
ggttacccaacacaagaacaaattgatttgatttataaaagaaaaccacgtgcaccctat
attgatgtagagtttaaggatggaacaaaagaaaaaatatggtgtacatttgatgaggaa
cagatagatttagatattagtaaaaaagctactaaagatttcattaaagaaaatttaaag
tttatgtgtgaaaatggagctgctctcattcgattggatgcctttgcttatgccaccaaa
aaagaaggaagtaattgcttttttatagaacctgatacatgggaaattcttgagtattgc
aaaaacatagtagaagagtatggagtggcgttattaccagaaattcatgaacactactca
atacagaagaaaattgcagaaaaaggctattacgtatatgactttgcattaccaatgtta
gttcttcatgccctatatagtgggactaacaaaagattaattaattggtttaatacatgt
cctaaaaagcaattcactactttagatacacatgatggaatagggatagtagatgtaaaa
gatttaatgacagatgaggagattgagcaaactaaatctaatctctatgaacaaggtgca
aatgttaaaaggaagtatagttcaacggcttataacaacctagatatttatcaagtcaat
tgtacctattactctgcattaggagataatgatgcagcctatttactagctagagctata
caatttttcgcaccgggtattccgcaggtttattatgtagggctatttgctggaaagaat
gatattgaattattagagaaaactaagaatggaagagatattaatagacattattataca
ttagaagaaatccagcaagagactcaaagggatgtagttaataaattatttaagttaatg
gcatttagaaataattataaggcatttgatggagagatgattatacatcctacggaatat
gaaaataagctaaagatagagtggattaataatgaatacagagcagtattagaagccgac
ttaaagcaaaaaagctttaatatcctatataaagatatagcagaagcagtttttaaacaa
cttgaactatag

DBGET integrated database retrieval system