KEGG   Cellulosilyticum lentocellum: Clole_0249Help
Entry
Clole_0249        CDS       T01448                                 

Definition
glycoside hydrolase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
cle  Cellulosilyticum lentocellum
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Clole_0249
  Lipid metabolism
   00600 Sphingolipid metabolism
    Clole_0249
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Clole_0249
Enzymes [BR:cle01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Clole_0249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
327364..329244
Genome map
AA seq 626 aa AA seqDB search
MNAKMTWLDDPEVFGVNKLAAHSDHLFYPSKEEMLKKESSLMQSLNGVWQFAYANNAKER
PIDFYKPEYDASGFGSIEVPSHIELNHHDKIHYINTMYPWEGHIYRRPVKEDTPEGIGLF
SEASYNPVGAYRTTFDLAPGLRNKPITICFEGVEQAMYVWLNGAFIGYGEDSFTPSEFDL
TPFIKEQGNVLCVEVHKRSCAAFLEDQDFFRFFGIFRNVTLYAKPELHVEDFYVKPELAE
DQRSGSFGVEMKLSGKVVKGTVKIYLRDQKGKELLAAQMPASEKVIFAPVTLEDITPWSH
ETPYLYEFLIEVYNEANVLVELVPYLVGFRRIEIKNNMMLLNGKRLRLLGVNRHEWSAKT
GRVITKEEMVWDIGCMLRNGINAVRTSHYPNQIPWYTLCDEAGLYVMAEVNMETHGSWQK
MGAVEPSWNLPGSDKKWLAAVLDRAKTNFEVFKNHPSILFWSLGNESYAEENIAAMHDYY
KAVDCSRLVHYEGVHHNRAYEDRISDVESRMYARPAEIIAYLENQPKKPFILCEYMHDMG
NSLGGMKDYMELFDRFEMYQGGFIWDFIDQGLMVNDEVTGAQVIRYGGDFDDRPSDYEFS
GNGIVFATREEKPAMQEVKYYYERYK
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaaaaatgacgtggttggatgacccagaagtattcggtgtaaacaaattggca
gctcatagtgaccatttattttatcctagtaaggaggaaatgcttaagaaggaatcttct
cttatgcaaagcctaaatggggtatggcagtttgcttatgctaacaatgccaaagaaaga
cctattgatttttataagccggagtatgatgccagtggatttggcagcatagaagtgcca
agccatattgaactcaatcatcatgataaaatccactatatcaacaccatgtatccttgg
gaaggccatatctatagacgtcctgtaaaggaagatacacctgaggggatagggttattt
agtgaggcaagctacaatcctgtaggtgcctatagaaccacctttgatttagcaccaggt
ttaaggaataagcctataaccatttgctttgaaggtgtagaacaggctatgtatgtctgg
ttaaatggcgcatttataggctatggcgaggatagctttacaccatcagagtttgattta
acaccttttataaaagaacaaggcaatgtgctttgtgtagaggtacataagagaagctgt
gcggctttcctagaagatcaagatttcttccgtttctttggtatttttagaaatgtaacc
ttatatgccaaaccagagcttcatgtagaagacttctatgtcaaaccagaactagcagaa
gatcagaggtcaggtagttttggcgtagaaatgaaactaagtggcaaagtagtgaaggga
actgtaaagatttatttacgtgatcaaaaagggaaagagcttttagcagcccaaatgcct
gcttctgaaaaagtcatttttgcaccagtaactttagaagatattaccccatggagtcat
gaaacaccttatttatatgagtttttaatagaggtgtataatgaggcaaatgtactagtg
gaactagtcccttatttagtagggtttagacgaatagagattaaaaataatatgatgcta
ttaaatggaaaaaggctacgtctacttggcgttaatcgccatgaatggagcgccaaaaca
ggtagagtcattactaaggaagaaatggtgtgggatataggttgcatgcttcgaaatggc
atcaatgcggtacgtaccagtcactatcctaatcaaatcccatggtacactttgtgtgat
gaggcagggctttatgtgatggcagaagttaatatggaaacacatggtagttggcaaaag
atgggggcagttgagccctcttggaatctaccaggaagtgataagaaatggctagcagcc
gttttagatcgggcaaagactaactttgaagtgtttaaaaatcatccctctattttattc
tggtcattaggtaatgaatcctatgccgaggagaatatagctgccatgcatgactactat
aaagcagttgattgtagtagattagtccattatgaaggcgtacatcataatcgcgcttat
gaggatagaatttctgatgtggagagcaggatgtatgctaggccagcagagattatagcg
tatttagaaaatcagcctaagaaaccctttattttatgtgaatacatgcatgatatgggg
aattctcttggggggatgaaggactacatggaactatttgaccgttttgaaatgtatcaa
ggcggatttatatgggatttcattgaccaaggcttaatggtaaacgatgaagtgacaggg
gcccaggtaattcgttatggtggagactttgatgacagaccatcggattatgagttttca
ggtaatggaatcgtctttgccactagggaagaaaaaccagccatgcaggaggtaaaatac
tactatgaacgctataaataa

DBGET integrated database retrieval system