KEGG   Cellulosilyticum lentocellum: Clole_0474Help
Entry
Clole_0474        CDS       T01448                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cle  Cellulosilyticum lentocellum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Clole_0474
Enzymes [BR:cle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Clole_0474
Exosome [BR:cle04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Clole_0474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
586311..587822
Genome map
AA seq 503 aa AA seqDB search
MEKYIIAMDQGTTSSRAIIFDKQQHIIGSSQKEFTQIYPKEGWVEHDPMEIWASQYGVLQ
EVMAKNNLTQENIAAIGITNQRETTIIWDKATGVPIYNAIVWQCRRTADFCEELKAKGWE
DYIKKNTGLVLDAYFSATKIKWILDHVEGARERANKGELLFGTVDTWLIWKLTNGKVHVT
DYTNASRTMIFNINTLEWDQTLLDLLDIPKCILPEVKNSSEVYGYANLGTKGGIRVPIGG
VAGDQQAALFGQGCFDKGDVKNTYGTGCFVLMNTGDELVKSKNGLLTTIAIGLDGQVQYA
LEGSVFVGGAVVQWLRDELRLVNDSSDTDYFASKVKDSGGVYVVPAFVGLGAPYWDMYAR
GGIVGLTRGTNRNHIIRASLESIGYQCRDVIDAMIEDVGHKLTSIKVDGGASKNNFLMQF
QADIIGAEVVRPKVVETTALGAAYLAGLAVGYWKDKREILEEWRVDCTFTPSLEEEKRDK
AYRGWKRAVKRCMAWEMEDQLEQ
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatatattattgcaatggaccaaggaacaacgagttcaagagctattattttt
gataaacagcaacatataataggaagtagccaaaaggaatttacacaaatttatcctaag
gaaggctgggtggaacatgatccaatggagatatgggcttctcagtacggtgtacttcaa
gaggtaatggcaaagaacaatttaacacaggaaaatattgccgccataggcattactaat
caaagagaaactacaatcatttgggacaaagcaactggagtacctatttacaatgcaatt
gtatggcaatgtagaagaacagctgacttttgtgaagaactcaaagcaaaggggtgggaa
gactacatcaagaaaaacacaggactcgttttagatgcctatttctcagctactaaaatt
aagtggattttggatcatgtagaaggtgccagagaaagagctaacaagggagagttactt
tttggaacggtagatacttggcttatttggaaattaaccaatggaaaagtacatgtaaca
gattatacgaatgcatctagaaccatgatttttaatattaatacattggaatgggatcaa
acattattagacctacttgatattccaaaatgcattttgccagaagtgaaaaattcttct
gaagtatatgggtatgctaatctaggaacaaaaggtgggatacgtgttcctataggaggc
gttgctggtgatcaacaagctgctttatttggacaaggctgctttgataaaggcgatgta
aaaaatacttatggaacaggttgctttgtactcatgaatacaggtgatgagctagtaaaa
agtaaaaatggacttttaacaactattgctattggattagatggacaagtacaatatgca
cttgaaggttctgtatttgtaggtggagcagtagtacagtggcttagagatgaactacga
ttagtgaatgactcttccgacacagattattttgcaagtaaggtaaaagatagtggaggc
gtctatgtagtacctgcctttgtgggattgggggcaccttattgggatatgtatgccaga
ggtggcattgttggattaaccagaggtactaatagaaatcatattataagggcatctctt
gagtctataggttatcaatgtagggatgtcattgatgcaatgatagaagatgtaggacat
aagctaacttctattaaagtagatggtggagccagcaagaataatttccttatgcagttt
caagcagatattataggagcagaagtagtgagacctaaggtcgttgaaacaacagcactt
ggagcagcttatttggcaggcttagctgtaggctattggaaagataagcgtgagatttta
gaagaatggagagtggattgtacttttacaccaagcttagaagaagagaaaagagataag
gcatatagaggctggaaaagagccgttaagcgttgtatggcgtgggagatggaagatcaa
ttagaacaatag

DBGET integrated database retrieval system