KEGG   Cellulosilyticum lentocellum: Clole_0518Help
Entry
Clole_0518        CDS       T01448                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cle  Cellulosilyticum lentocellum
Brite
Enzymes [BR:cle01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Clole_0518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(641564..645715)
Genome map
AA seq 1383 aa AA seqDB search
MSLLKKRIAYLTTSTLLASSVLGITPCLFASSTPSTITYNFDGGTEGWIARGDAQVTTTS
SSLTIDSTNHCLYVTNRTSNWHGVSKELKDTLKAGETYTFSVYVKYDEGADTESLSLTLE
TGLEENGYITIASNSAVSKGEWTQLTGEVTVPEAATKANVYMEAANADLSFYVDELKITG
SFATDSPEVPNAPLTTWDFESGLGDWSVRGSGEATAEVSTTAPHGGNQCAFVSGRTQDWN
GIQVNLTNSAKKGGKYTFEAWVKYDAADEGTEQFVLALQYDAESESSTQYKWITNADVKN
GEWTKLQGEYTLPKDFTDISLYIQVNGSTIDFYADDITMQGEPELDVEIQKDIPSLKEVY
SDYFKFGTAIASNNLNDLEQELVLKHFNSITHENALKPESILDHAATIAYMNANGDQTHP
QVTLSSDAKATLDFARDNHIPVRAHVLVWHSQTPNWLFTENYSTEKDAPVVSKEVMKQRL
ENYTNAYFKLLSEEYPDVDFYAIDVVNEAVNPDRPDGLRAPATVATTSGDDDNDENANNS
MWMTTIGAEFIEDAFTYARAAADQYMPNVKLAYNDYNECDPKKTEIIYSICKDLYDKGLL
DVVGMQGHYNMSSPSTSQFENALLKYASIGDNIEIQITELDITQDDTSEEGLIKQAYRYK
GFLDIMKKLDSEGAANITSCVVWGVKDDESWRSERLPLLFDADYQAKPSFWAITDSSKLP
VLAQEVKAYSLGSKDYTHAFLIQKGTALETTSGTQIASYKVAWDANNIYVNVIPTEKGKS
GTVKVFLNDNSISANLTDNTVIQIPLSEAISEGGTLSFDLFVQVGDEKATWNNLAYDGTS
APNQSTFGKLLLSKAPHSSSAIKGTPIIDGKMDGLWNKAETINVNTFSIGTSGATATAKA
LWDENYVYVLVEVKDSLLSKASTNTYEQDSVEIFIDEDNAKSTSYELGDIQYRVNFDNER
SINGASDADSFITATQIIDGGYIVEAALPSRIAAFTKNQVVGFDFQINDDADGNGKRDNV
SNWNDLTGNGWSSTAGYGVLQLVKPTTSDDSGSGSGSGSGAGSGTGSSSTSTSTTSVNKT
PDQIIASALSDNTALELSIGTTPITISQNSIEQLSTQEKALVLKSGKVTATITPAFINTN
LSNANKILSSLEVSMLPVSDTLFTSLKNQLAKDDNLSIVGTSANTSVINIKGHSSLSTFT
EPLLLSVDLVNATITDSSHLTLARVSKNTDGTFTFTQLGGDYQLNNHTLTGYVTEPGTYI
VIEKKNLIKLNLIIGKTTINSNQSTSITSDTAPKIVNGTTMVPLRFVAEQLGADVKWNAV
NKEITLLFDNQKVILNMGKGQTSSNPETILENGRTLVPLRYVSENLGANVLWIPSSKTIE
IVK
NT seq 4152 nt NT seq  +upstreamnt  +downstreamnt
atgagtctactaaaaaaaaggatagcttatctcacaacttcaactttacttgcaagttca
gtgcttggaataacaccttgtctctttgctagttcaacgccaagcactatcacctacaat
tttgatggaggtactgagggctggatagcaagaggagatgcgcaggttactacaaccagt
tccagcctcaccattgattcaactaatcattgtttgtatgtaacaaacaggacctctaat
tggcatggtgtttcaaaggagctaaaagatacacttaaagcgggtgaaacctatacattt
agtgtctatgtaaaatatgatgaaggtgcagataccgaatcacttagcttaactttagaa
acaggactagaggaaaatggttatatcactatcgctagtaattctgctgtatcaaagggt
gaatggacccagctaacaggtgaagttaccgtaccagaagctgcaaccaaagctaatgtt
tatatggaagcagctaacgctgatcttagtttttatgtagatgagcttaaaatcacaggt
tcatttgctactgattctccagaggttcctaatgctccccttactacttgggattttgaa
tcaggcctaggtgattggtcagtcagaggttcaggcgaagcaacagcagaagtttctact
actgcacctcatggcggcaatcagtgcgcttttgtatctggtcgtacacaggattggaat
ggtatccaagtcaatctaacaaattcagctaaaaaaggtggcaaatacacctttgaagct
tgggtaaaatatgatgcagccgacgaaggaactgagcaattcgttctagcattacaatat
gatgctgaaagtgaatctagcactcagtataaatggattactaatgctgatgtcaaaaat
ggtgagtggactaaattgcaaggtgaatataccttacctaaagactttactgacatttct
ctttacatacaagttaatggtagtacaattgatttttatgcggatgatattacaatgcaa
ggtgaacctgaactggatgtagaaattcaaaaagatattccttctttgaaagaagtgtat
agtgattatttcaaattcggtacggctattgcttctaataacttaaatgacctagaacaa
gagctagtactcaagcactttaatagcatcactcatgaaaatgctttaaaaccagaatca
attttagaccatgctgccactatagcgtatatgaatgctaatggtgatcaaacacatcct
caagttaccttaagttccgatgctaaagcgactttagattttgctagggataatcatatt
cctgtaagagcccacgttcttgtatggcattcacaaacgccaaactggctatttacagag
aattactcaacagaaaaagatgctcctgttgtttctaaagaagtgatgaaacaaaggtta
gaaaactatactaatgcttatttcaaattattatcagaagaatatcctgatgttgatttt
tatgctattgatgtagtcaatgaagctgtcaacccagaccgtccagatggtttacgtgct
cctgccacagtagctactacttctggtgatgatgataatgatgaaaacgctaataactct
atgtggatgacaaccattggtgctgaattcattgaagatgcttttacttatgcaagggct
gcagctgaccaatatatgccaaatgtaaaacttgcatataatgactataatgagtgtgat
cctaaaaaaactgaaattatatatagcatttgtaaggatctttacgataaaggcctctta
gatgttgttggtatgcagggacattacaatatgtcttcaccaagtacctcccaatttgaa
aatgcactgcttaaatatgcttcaattggtgataatattgaaattcaaattaccgaatta
gatatcactcaagatgatacttctgaagaaggattaattaagcaagcttatcgctataaa
ggattccttgatattatgaaaaaactagattctgaaggtgctgcaaatatcacttcctgt
gttgtgtggggtgtaaaagatgatgaatcttggagaagtgaaagactccctcttcttttt
gatgctgactatcaagctaaaccttcattctgggcaatcacagattcaagcaaacttcct
gttcttgctcaagaagtaaaagcctatagcctaggcagcaaggattatactcatgctttt
ctaattcaaaaaggtactgctttagaaacaactagtggtactcaaattgcttcctataag
gtggcttgggatgcaaataatatttatgttaatgtcattcctactgaaaaaggtaaatct
ggcactgttaaagtgttccttaatgacaatagtatttctgctaaccttaccgataatacc
gtcattcagattcctttatctgaggctatttccgaggggggtactttaagctttgatctc
tttgttcaagtcggagacgaaaaagctacttggaacaatctagcttatgatggtacttct
gcacctaatcaatctacctttgggaaactattacttagcaaagcgccccactcctcctct
gccattaaaggtacacctattattgatggaaaaatggatgggctttggaacaaggctgaa
accatcaatgttaacaccttctctattggtacctctggggctactgccacagcaaaagct
ctttgggatgagaactatgtttatgtcttagtagaagttaaagacagcttattaagcaaa
gcaagtactaatacttatgaacaggattcagttgaaatctttattgatgaagataatgcc
aaatccacttcttatgaattaggagacattcaataccgtgtcaacttcgataatgaacgt
tctatcaacggtgcttctgatgcagacagctttattacagcaacccaaattattgatggt
ggttatattgtggaagctgctcttccttctcgcattgctgccttcactaagaatcaagtt
gttgggtttgattttcaaattaatgatgatgcagatggcaatggcaagagagataatgtc
tctaactggaatgatttaactggcaatggttggtcaagtacagctggctatggtgtttta
caattagtcaaacctactacttcagatgattcaggttctgggtctggttctggatctggg
gctgggtctggtaccgggtcaagctctacttctacctcaactacatccgttaacaaaact
cctgaccaaatcatcgcgtctgctttatccgacaatacagcacttgaattatctattggt
actactcctattactattagtcaaaattcaattgaacagttgtctactcaagaaaaggcc
ttagtattgaaatctggaaaagtaacagcaacaataacacctgcctttatcaatactaat
ctctctaatgctaataagattttatcttcattagaagtatctatgctaccagtatcagat
acattatttacctcactcaaaaatcaattagcaaaagatgataacttgtctatagttggt
acttcagctaacacgagtgttataaatattaaagggcatagtagcctttcaacatttact
gaaccattactccttagtgtcgatttagtgaatgcaaccattactgattcttctcactta
actttagcaagagttagtaagaatactgacggtactttcacattcactcaactaggcgga
gactaccagttaaataatcatacccttaccggatatgttactgagccaggtacttatatt
gttattgaaaagaaaaaccttattaagttaaacttaataattggcaaaactacaataaac
tccaaccagtctactagtattaccagtgatactgctcctaaaattgtaaatggtacaact
atggtacctctccgttttgtggcagaacaacttggtgcagacgttaaatggaatgcagta
aataaagaaataaccttattatttgacaatcaaaaagtaatcttaaatatgggcaaaggt
caaacctcttctaacccagaaacaatacttgaaaacggtagaactttagttcctcttaga
tatgtttctgaaaatcttggcgctaatgtcctatggattccaagtagtaaaaccattgaa
attgtaaaataa

DBGET integrated database retrieval system