KEGG   Clostridium lentocellum: Clole_0606Help
Entry
Clole_0606        CDS       T01448                                 

Definition
(GenBank) Alpha-galactosidase
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
cle  Clostridium lentocellum
Pathway
cle00052  Galactose metabolism
cle00561  Glycerolipid metabolism
cle00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Clole_0606
  Lipid metabolism
   00561 Glycerolipid metabolism
    Clole_0606
   00600 Sphingolipid metabolism
    Clole_0606
Enzymes [BR:cle01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Clole_0606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C
Motif
Other DBs
NCBI-ProteinID: ADZ82340
UniProt: F2JMZ8
Position
760990..762381
Genome map
AA seq 463 aa AA seqDB search
MKYIEDRVEDIQITYIGGGSRGWAWQLMSDLAREPQLAGTVTLYDIDYEAALQNEKIGNR
LKDREDVKGKWQYRADKSLESALKGADFVVISILPGTFDEMASDVHAPEKYGIYQSVGDT
VGPGGLIRGLRTVPMYVEFAKAIEKNCPEAFVINYTNPMSLCVKTLYEVFPGIKAFGCCH
EVFNAQNLLAAALKDIEGIEGATREEIKINVKGINHFTWIDEASYKGLDLMPIYKQFVDK
YYENGFEEGKTGNWMNDFFESANRVKFDLFKRYGIIAAAGDRHLAEFMSGNWYIENPETV
MDWKFSLTPVSWRKEDLKERLAKSKRLVKGEEVFEVKDSGEEGVRQIKALVGLEELVTNV
NLPNEGQIFNLPRGSIVETNAIFRRGQVLPIVAGKLPSAIQGIATRHITNAHLILEAALE
KDKKKAFVAFANDPLVNISLEDTEELFEEMLKNTAAYLPGWKL
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacattgaagatagagtcgaagatatacaaatcacctatattggtggggggtct
agaggttgggcatggcaactgatgagtgatttggcaagagagccacaattagcggggaca
gtaacgctttatgatattgattatgaggcagcattgcagaatgaaaagataggtaatcgt
ctaaaagatagagaagatgtcaaaggtaagtggcaatatagggcagataaaagcttggag
agtgctttaaagggagcagattttgttgtgatttccattttgccaggtacttttgatgag
atggcttccgatgtacacgcaccagaaaaatatgggatttatcaatctgttggggataca
gttggcccagggggacttattagggggctaagaaccgtccctatgtatgtggagttcgca
aaagctatagaaaagaattgtcctgaggctttcgttattaactataccaatcctatgtct
ttatgtgtaaaaacgctttatgaggtatttccagggattaaagcatttggttgttgccac
gaggtatttaatgcacagaatttattagcagcagcattaaaggatatagagggcatagaa
ggagctacaagagaagaaatcaagataaatgtcaagggaattaatcattttacttggatt
gatgaggcttcttataaaggattagatttaatgccaatttacaaacagtttgtagacaaa
tattatgaaaacggttttgaagaaggaaaaacaggaaactggatgaatgacttctttgaa
tcagctaatagagtgaagtttgatctttttaagcgatacggtattattgcagcagcagga
gatagacacctagctgagtttatgtcaggtaactggtatatagagaatccagaaacagtt
atggattggaaatttagtttaacacctgttagctggagaaaagaggatttaaaagaaaga
ttagctaaaagtaagagacttgttaaaggcgaagaagttttcgaagttaaagattcagga
gaagaaggcgttagacaaatcaaggcattagttggtctcgaagaactagtaaccaatgtt
aacttgcctaatgaaggtcaaatctttaatctgccaagaggctctattgtagaaaccaat
gccatttttagaagaggacaggtattacctatagtagcgggaaaacttccaagtgctatt
caaggaatagcaacacgccatattaccaatgcacatcttattctagaagccgcattagaa
aaagataagaaaaaagcttttgtagcttttgctaatgatccattagtcaatatatcctta
gaggatacagaggagctttttgaagaaatgctcaaaaatacagcagcttatttacctggc
tggaaactataa

DBGET integrated database retrieval system