KEGG   Clostridium lentocellum: Clole_0608Help
Entry
Clole_0608        CDS       T01448                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cle  Clostridium lentocellum
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cle00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cle00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(764456..764944)
Genome map
AA seq 162 aa AA seqDB search
MICLIAAVSKNNQIGLHNQMPWHIPEDLAYFREVTSGHTVIMGRKTFESIGKPLPHRTNM
VLTTNPNFSAEGVVVLHSLNEALELCKTTTEAVFVIGGGEIYKAFLPFAEYLYITLIDEV
VEGDTCFPDYQKDFQLIKSTCSKSQTSTGHYFFFTLWKRIGH
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
ttgatttgtttaatcgcagctgttagtaaaaataatcaaattggacttcacaatcaaatg
ccttggcatattcctgaagacctagcttattttcgtgaagtaacaagtgggcatactgtt
atcatgggaagaaagaccttcgaaagcataggtaaacctctcccccatagaaccaatatg
gttttaactacaaaccctaacttctctgcggagggtgttgttgttttgcatagcttaaat
gaagcattagagttatgcaaaacaacaacagaagcagtttttgtaattggtggtggtgaa
atttataaagcctttttacctttcgcagaatatttatacattactttaattgatgaagtt
gttgagggtgatacttgctttcccgattatcaaaaagattttcaattgataaaatccact
tgtagtaagtcgcaaacatctactggtcattattttttctttactctttggaaaagaata
ggtcattaa

DBGET integrated database retrieval system