KEGG   Clostridium lentocellum: Clole_0704Help
Entry
Clole_0704        CDS       T01448                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cle  Clostridium lentocellum
Pathway
cle00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cle01100  Metabolic pathways
cle01110  Biosynthesis of secondary metabolites
cle01130  Biosynthesis of antibiotics
cle01230  Biosynthesis of amino acids
Module
cle_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clole_0704
Enzymes [BR:cle01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Clole_0704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS ThiG DUF1694 PDZ QRPTase_C FMN_dh
Motif
Other DBs
NCBI-ProteinID: ADZ82437
UniProt: F2JNT9
Position
900477..901265
Genome map
AA seq 262 aa AA seqDB search
MILDQIIADRKRAVAALKERYSTSQLMGDIEFQNFATLDFKKALKREDERSIHIIAEVKK
ASPSKGLICQDFNYLTIAKDYEIGGASAISVLTEPKYFQGDNHYLTTIKEKVKLPILRKD
FIIDEWQIYEAKSIGADAILLIVAALSETQLRNYLSLAKSLQLQTLVETHDAREVDGALS
AGAEVIGVNNRNLRNFEVSLETSIRLRALVPKDKVFVAESGIHTTQDMALLKEIGCDAAL
IGESLMTASNRVEKLQLFKGAY
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgatactagaccaaattatagcggatagaaaaagggcagtagcagcacttaaagaacgc
tattctacttcccagttaatgggggatatagagtttcaaaactttgctactttggatttt
aagaaagcactaaaaagagaagatgaaaggtccatccatattattgctgaggtaaaaaaa
gcctcaccttctaaaggtttgatatgtcaggattttaattatctaactattgctaaagac
tatgaaataggaggtgcatctgctatatcagtacttactgagcctaagtattttcaggga
gataatcattatttgacaactattaaggaaaaggtgaaactccctattcttagaaaagat
ttcattattgatgagtggcaaatctatgaagcaaaatcaataggagcagatgcgatctta
cttattgtagctgctttatctgaaactcagctaagaaactatttaagcttagcaaagagt
ttacagttgcaaacacttgtagaaacccatgatgcaagagaagtagatggagcgttgtca
gctggggcagaagtgataggggttaataatagaaacttacggaactttgaagtaagctta
gaaacctctattcgactaagagctttagtacctaaagacaaagtatttgtagctgaaagt
ggcattcatacaactcaggatatggctttattaaaagaaataggctgtgatgcagcatta
ataggagaaagtttgatgactgcgtctaatagagtggagaaactacagctatttaaagga
gcttattag

DBGET integrated database retrieval system