KEGG   Clostridium lentocellum: Clole_0706Help
Entry
Clole_0706        CDS       T01448                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cle  Clostridium lentocellum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Clole_0706
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clole_0706
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clole_0706
Enzymes [BR:cle01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Clole_0706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
901973..903160
Genome map
AA seq 395 aa AA seqDB search
MKETGRYGIYGGQYIPETLMSAVKELEEAYAYYKEDEAFNRELEELFAKYTGRPSLLYYA
DKMTKDLGGAKVYLKREDLNHTGSHKINNVLGQVLLAKRMGKKRIIAETGAGQHGVATAT
AAALMGMSCEVFMGEEDTIRQALNVFRMELLGAKVTSVLTGTRTLKDAVNAALQDWTRTV
EDTFYCIGSVMGPHPYPEMVRDFQSIIGKEIKSQMLEAEGKLPDVVIACVGGGSNAMGAF
YEFIPNKEVKLTGVEAAGHGIHTTEHAATLSKGEVGIFHGMKSYFLQTEEGSIAPVYSIS
AGLDYPGIGPEHAYLFDTGRAAYVPATDEEAVAAFEYLSKTEGIIPAIESSHAIAYAMKI
AGTMRKDQTIVINVSGRGDKDVAAIARYKGVDVHE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaacaggtagatatggcatttacggaggacaatatatcccagagacattgatg
agtgctgtgaaggaattagaggaagcttatgcctattataaagaagatgaagcttttaat
agagagctagaggaactttttgcaaagtatacgggtagaccttctttgctttattatgca
gataagatgacgaaggacttaggtggtgctaaggtttatttaaagagagaggacctcaat
catacagggtctcataaaattaataatgtgttaggccaagtgttattagcaaaacgtatg
ggtaaaaaacgtattattgcagaaacaggcgcaggtcaacatggcgtagccacagccaca
gcagcagcacttatgggaatgagttgtgaggtgtttatgggggaagaagataccattaga
caggcacttaatgtatttcgtatggagcttctaggtgcaaaggtaacatcggttttaacg
ggaactaggaccttaaaagatgcagttaatgcagcacttcaagattggaccaggacggta
gaagataccttttattgtattggttctgttatgggtcctcatccttatccagaaatggta
agagattttcaaagtattataggaaaggaaataaaaagtcagatgttagaagcagaaggc
aagttgccagatgtagtcattgcttgtgtaggtggaggcagtaatgccatgggggctttt
tatgaatttattcctaataaggaagtaaagcttacaggcgtagaagcagcaggacatggt
attcatacgacagaacatgcagctaccttaagtaagggtgaagtaggtatttttcatggc
atgaaatcttatttcttacaaacagaggaaggtagtattgcacctgtgtattccatttca
gcaggacttgattatccaggtattggaccagagcatgcgtatctttttgacacaggaaga
gctgcctatgtgccagctactgatgaagaagcagtagctgcttttgaatatctttcaaaa
acagagggaattattccagccattgaaagctctcatgccatagcttatgctatgaaaata
gcaggtaccatgagaaaggatcaaaccattgtaatcaatgtttcaggaagaggcgacaag
gatgtagccgctattgctagatataagggggtagatgtacatgagtaa

DBGET integrated database retrieval system