KEGG   Cellulosilyticum lentocellum: Clole_1032Help
Entry
Clole_1032        CDS       T01448                                 

Definition
recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
cle  Cellulosilyticum lentocellum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cle00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Clole_1032
DNA repair and recombination proteins [BR:cle03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Clole_1032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1186082..1186684
Genome map
AA seq 200 aa AA seqDB search
MAGYYGDKMVALIEELSRLPGIGSKSAQRLAFHIISMPVEKVEHLANTLVAAKKHINYCE
KCCTITDDKLCPICKDSNRANGQIMVVEDPRDMAAYEKTKEFKGLYHILHGAISPMMGVG
PSDIKIKELLERIQKEAIEEVIIATNPNIEGEATAMYISKLLKPLGIKITRIAHGVPVGG
DLEYVDEITLTRALEGRREM
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
gtggctggctattatggagataagatggtagctcttatagaagagttatcaagattgccg
ggaataggaagtaaatctgctcaacgtttggcttttcatattattagtatgcctgtagaa
aaagttgagcatttagcaaatactttagtagctgctaaaaagcatattaactattgtgag
aaatgctgtacgattacagatgataagctttgtcctatttgtaaggattctaatagggct
aatggtcaaattatggtggtagaagacccgagagatatggcagcttatgaaaaaacgaag
gaatttaaaggactgtatcatatactacatggtgctatttcgcctatgatgggagtaggt
cctagtgatatcaagattaaagagcttttagagcgtatccaaaaggaagccatcgaagaa
gtgattattgccactaatcctaatattgagggtgaggcaacagctatgtatattagtaag
ttattaaagccccttggtataaaaattacccgtatagctcatggtgtaccagtaggtgga
gatttggagtatgtagatgaaattacacttaccagagcgttagaaggtagacgtgaaatg
tag

DBGET integrated database retrieval system