KEGG   Cellulosilyticum lentocellum: Clole_1090Help
Entry
Clole_1090        CDS       T01448                                 

Definition
alpha/beta hydrolase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
cle  Cellulosilyticum lentocellum
Brite
Enzymes [BR:cle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Clole_1090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1254557..1255336
Genome map
AA seq 259 aa AA seqDB search
MHYIDRWTLHRHQKEYYKKRPFSDTVVIFIHGILEGNMQFRNLGSIAYKEGYSVLILLLP
GHGETGETFAKVHLNQWVDYVNKQVQQMEREYKYIILVGHSMGSLLAIGYAAHFPGKIKS
LVLFALPLAIELKYRVIKGAIKIATGRLSEKEPYVIAECRAIGVGKTKSWTYIKWIPRYI
DLFILISYIKKQLNKIKKPVLVIQSKKDEFVPVRVIRLIQQQLVTSKIIILGDSGHFCYH
HSDINRLESAFKQFLQEEK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcactatattgatagatggacattacacaggcatcaaaaagaatattataagaaaaga
ccgttttcagatactgtagttatttttattcatgggatactagaaggcaatatgcaattt
agaaatttagggtctatagcgtataaagaaggatattcagttctaattttattgttacca
ggacatggagaaacaggtgaaacatttgcaaaagtacatttgaatcaatgggtcgactat
gttaataagcaggttcaacagatggaaagggagtataaatatattattttagttggacat
tccatggggagtttattagctataggatatgcagcgcatttcccgggaaaaataaaatct
ttagtactttttgcactgccattagctattgaattaaagtatagagttattaaaggggcc
attaaaatcgctacggggagactttctgaaaaagagccttatgttattgctgagtgtaga
gctataggtgtaggaaaaacaaaaagctggacgtatattaagtggattccaagatatata
gatcttttcattttaatttcatatatcaaaaagcaattaaacaaaatcaaaaagcctgtt
cttgtaattcaatcaaaaaaagatgagtttgtaccagtgagagttataaggttgatacag
caacaattggttaccagtaaaataataatactaggtgattctggccatttttgttatcat
cattcagatatcaatagactagaatcagcctttaagcagtttttgcaagaagaaaaataa

DBGET integrated database retrieval system