KEGG   Cellulosilyticum lentocellum: Clole_1221Help
Entry
Clole_1221        CDS       T01448                                 

Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
cle  Cellulosilyticum lentocellum
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Clole_1221
   00500 Starch and sucrose metabolism
    Clole_1221
Enzymes [BR:cle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Clole_1221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1401825..1402793)
Genome map
AA seq 322 aa AA seqDB search
MIVAKNNQGDFDSVQAAIDSIPSSNTTWCTIYIKNGVYKEKIHITSPYIRLIGESADKTI
ITYDDYAYKLFPTGESYGTFNSYTMFVGTSDFHAENLCIENSSGIGDKVGQAIAAYVDGD
RVCFKNCRFIGYQDTLFTGPLPPKPIVPGSFRGPRENAPRINGRQYYENCYIQGDIDFIF
GSATAFFYSCTIFSNDIGKKVNGYITAPSTPEGQAYGYVFEDCKITSHCPKHTVYLGRPW
RHFAKSVFINCDLGAHIIPAGWHNWDKPDSEKVNFFGEYNNKGPGYTPTERVNWSHLLSD
MEAKHYSRQNVLNGSDNWTPWS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattgtagcaaagaataaccaaggagattttgattcagtgcaagctgctattgatagt
attccaagctctaatacaacttggtgtacaatatacatcaaaaatggcgtttacaaggaa
aaaattcacattacttctccttacattagacttattggcgaaagtgctgataaaacaatt
attacttatgatgattatgcctataagctttttcctactggcgaaagctatggtaccttc
aactcctataccatgtttgtaggtacatctgattttcatgcagaaaatctttgtattgaa
aatagtagtggcataggtgacaaagtaggacaagctattgctgcttatgtggacggcgat
cgtgtgtgttttaaaaattgccgctttataggctatcaagataccctctttacaggccca
ttaccacccaagcctattgtacctggttcatttagaggtccccgtgaaaatgcacctcgc
attaatggtagacaatactatgaaaactgttacatccaaggagatatcgattttatcttc
ggctctgctaccgctttcttttatagctgtaccattttttctaatgatataggcaaaaaa
gtaaacggctatattactgctccttccacacctgaaggccaagcttatggttatgtcttt
gaagattgtaagattactagtcattgtccaaaacacaccgtttatctaggacgtccttgg
aggcattttgccaaaagcgtatttattaattgtgatttaggagctcatattatccctgca
ggttggcataactgggataagcctgacagtgaaaaagtaaacttctttggtgaatataac
aacaaaggcccaggatatactcctacagaacgtgttaattggtctcatttattaagtgac
atggaggctaaacattactctcgtcaaaatgtactaaacggtagtgataattggactcct
tggagttaa

DBGET integrated database retrieval system