KEGG   Cellulosilyticum lentocellum: Clole_1317Help
Entry
Clole_1317        CDS       T01448                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cle  Cellulosilyticum lentocellum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Clole_1317
Enzymes [BR:cle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Clole_1317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1505245..1506171)
Genome map
AA seq 308 aa AA seqDB search
MKKSNILVIGSLNMDWIIEVDHTPIAGETLLGHFAKEVPGGKGANQAYAASSLGGHVTML
GAVGKDPSGEKLLQSLQKAGVNTSPIQANSETGSGMAIIYLNKMGNNSIVVLPNANNTVT
KEVIMAHDELFKIADIIMLQLEIPLEAVYEAAALAHKYHKTIILNPAPAISHLPNEILSK
IDYITPNETELSTLTNQPVTTVDDAIIAAQTLLLSGVKHVITTLGEKGAILVTLEEARHF
PALSVKAIDTTAAGDSFNGALAVYLAEGKSIEEAIVFGNQVAAITVTREGAQSSIPFREE
ILPTTENL
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtcaaatatattagtcataggaagcttaaatatggattggattattgaagtg
gatcatacacctatagctggtgagaccttactaggccattttgcaaaagaagttcctggt
ggtaagggggctaatcaagcttatgctgcttctagcttaggtggtcatgtgactatgcta
ggtgctgtaggcaaggacccttccggtgaaaagctcctacaaagccttcaaaaagcaggt
gtaaatacctctcctattcaagcaaattcagaaacgggctctggtatggccattatctat
cttaataagatgggtaataattctatcgtagtactccctaatgccaataacacagtaaca
aaagaagtgattatggctcatgatgagctctttaaaatagctgacattattatgctacaa
ttagaaattcctttagaagctgtctatgaagctgctgccttagcacacaagtatcataag
accattatccttaatccagcacctgccattagtcatttacctaatgaaatactaagtaaa
attgattatataacccctaacgaaaccgaactgagcactttaacaaatcaacctgttact
acagtagatgatgctattattgctgcacaaactttacttctctctggtgttaaacatgtc
attacgactttaggtgaaaaaggcgccattttagtcacactagaagaagctcgtcacttc
cctgcactcagtgtcaaggcaatcgatacaactgctgctggagactcctttaatggcgcc
ttagctgtttatcttgctgaaggaaaatccattgaagaagctattgtctttggtaatcaa
gtggctgctataacagttactcgtgaaggtgctcaaagttcaattcctttccgagaagaa
atactacccactacagaaaacttataa

DBGET integrated database retrieval system