KEGG   Cellulosilyticum lentocellum: Clole_1355Help
Entry
Clole_1355        CDS       T01448                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cle  Cellulosilyticum lentocellum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Clole_1355
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clole_1355
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Clole_1355
Enzymes [BR:cle01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Clole_1355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1547289..1548767
Genome map
AA seq 492 aa AA seqDB search
MLYTSTRKKLENITSTKAILQGISEEGGLFIPTELPKMDFTLDELSKWGYQELAYRVIKL
FFEDIKEEDLKHCITHAYDEKFDTKEITPLVHTKTANFLELFHGPTIAFKDMALSILPYF
MLVSKKYNKEEKDIVILTATSGDTGKAALEGFANVEGTKIIVFFPQDGVSEVQKRQMLTT
EGDNTLVVGVEGNFDDCQTTVKEIFADKEFAKEIADKNYKFSSANSINIGRLVPQVAYYF
AAYGKMMKDGKLKAGEAMNVVVPTGNFGNILAAYYAKQMGLPIQKLICASNTNKVLFDFL
QTGTYDRNRAFHLTTSPSMDILISSNLERLLYHISGESTEEVCSLMNALKTKGQYTISDE
MKANLKDFYGGYADDQMTKDYIKKVYNEENYLMDTHTAVAYAVYDTYVKDTKDHTPTVII
STASPYKFTGSVMSAIDEKYEGVNDFTLLEEMHHLIQGAMPKAMDQIATRPIKHKKVCEV
QGMKQVVSDFLV
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgctatatacaagtacacgaaagaaattagaaaatattacatcaacaaaggccatttta
caaggtatttctgaagaaggtggtttgtttattcctacagaactacctaaaatggacttt
actttagacgagctatcaaaatggggatatcaagaattagcttatcgtgtgattaagctt
ttctttgaagatataaaagaagaagatcttaaacattgcattactcatgcatatgatgaa
aaatttgatacaaaagaaattacaccacttgtacatacaaaaacagcaaactttttagag
ctttttcacggtcctactattgcatttaaggacatggcattatcaattctaccttatttt
atgcttgtaagtaaaaagtataataaagaagaaaaagatattgtcattttaacagccact
tctggagatacaggtaaagctgctttagaaggatttgctaatgtagagggcactaaaatt
attgtattttttccacaagatggtgtaagtgaggtacaaaaacgccaaatgcttactaca
gagggggataatactttagtagtaggtgtagaaggaaactttgatgattgtcaaacaaca
gttaaagagatttttgcagataaggagtttgctaaggaaatagcggataagaattataaa
ttttcttctgctaactctattaatatcggtagacttgtaccacaagtagcctattatttt
gcagcttatggaaaaatgatgaaggatggaaagcttaaagccggtgaagctatgaatgta
gttgtaccaacaggcaactttggtaacattcttgcagcttattatgcaaaacaaatggga
cttccaattcaaaaacttatctgtgcatctaatacgaataaagtactttttgatttctta
caaacaggtacttacgatagaaatagagcattccatttaacaacttcaccttctatggat
attttaatttctagtaatttagagagactcctttatcatattagtggagagtctacagaa
gaagtctgcagtttgatgaatgctttaaaaacaaaagggcagtatactatatcagatgaa
atgaaagctaatttaaaagatttttatggtggttatgcagatgaccaaatgacaaaagat
tatattaagaaagtatataatgaagaaaattaccttatggacacgcacacagctgtagct
tatgctgtatatgacacttatgtaaaagatacaaaagatcatacaccaacagtgattata
tcaacagcaagcccctataaatttacaggaagtgtaatgagtgcaattgatgagaagtat
gagggggttaatgactttactttattagaagaaatgcatcaccttattcaaggagctatg
ccaaaagctatggaccaaatagcgacaagacctattaagcataaaaaagtatgtgaagta
caaggtatgaagcaagttgttagtgattttttagtataa

DBGET integrated database retrieval system