KEGG   Clostridium lentocellum: Clole_1355Help
Entry
Clole_1355        CDS       T01448                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cle  Clostridium lentocellum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cle01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cle00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:cle00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1547289..1548767
Genome map
AA seq 492 aa AA seqDB search
MLYTSTRKKLENITSTKAILQGISEEGGLFIPTELPKMDFTLDELSKWGYQELAYRVIKL
FFEDIKEEDLKHCITHAYDEKFDTKEITPLVHTKTANFLELFHGPTIAFKDMALSILPYF
MLVSKKYNKEEKDIVILTATSGDTGKAALEGFANVEGTKIIVFFPQDGVSEVQKRQMLTT
EGDNTLVVGVEGNFDDCQTTVKEIFADKEFAKEIADKNYKFSSANSINIGRLVPQVAYYF
AAYGKMMKDGKLKAGEAMNVVVPTGNFGNILAAYYAKQMGLPIQKLICASNTNKVLFDFL
QTGTYDRNRAFHLTTSPSMDILISSNLERLLYHISGESTEEVCSLMNALKTKGQYTISDE
MKANLKDFYGGYADDQMTKDYIKKVYNEENYLMDTHTAVAYAVYDTYVKDTKDHTPTVII
STASPYKFTGSVMSAIDEKYEGVNDFTLLEEMHHLIQGAMPKAMDQIATRPIKHKKVCEV
QGMKQVVSDFLV
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgctatatacaagtacacgaaagaaattagaaaatattacatcaacaaaggccatttta
caaggtatttctgaagaaggtggtttgtttattcctacagaactacctaaaatggacttt
actttagacgagctatcaaaatggggatatcaagaattagcttatcgtgtgattaagctt
ttctttgaagatataaaagaagaagatcttaaacattgcattactcatgcatatgatgaa
aaatttgatacaaaagaaattacaccacttgtacatacaaaaacagcaaactttttagag
ctttttcacggtcctactattgcatttaaggacatggcattatcaattctaccttatttt
atgcttgtaagtaaaaagtataataaagaagaaaaagatattgtcattttaacagccact
tctggagatacaggtaaagctgctttagaaggatttgctaatgtagagggcactaaaatt
attgtattttttccacaagatggtgtaagtgaggtacaaaaacgccaaatgcttactaca
gagggggataatactttagtagtaggtgtagaaggaaactttgatgattgtcaaacaaca
gttaaagagatttttgcagataaggagtttgctaaggaaatagcggataagaattataaa
ttttcttctgctaactctattaatatcggtagacttgtaccacaagtagcctattatttt
gcagcttatggaaaaatgatgaaggatggaaagcttaaagccggtgaagctatgaatgta
gttgtaccaacaggcaactttggtaacattcttgcagcttattatgcaaaacaaatggga
cttccaattcaaaaacttatctgtgcatctaatacgaataaagtactttttgatttctta
caaacaggtacttacgatagaaatagagcattccatttaacaacttcaccttctatggat
attttaatttctagtaatttagagagactcctttatcatattagtggagagtctacagaa
gaagtctgcagtttgatgaatgctttaaaaacaaaagggcagtatactatatcagatgaa
atgaaagctaatttaaaagatttttatggtggttatgcagatgaccaaatgacaaaagat
tatattaagaaagtatataatgaagaaaattaccttatggacacgcacacagctgtagct
tatgctgtatatgacacttatgtaaaagatacaaaagatcatacaccaacagtgattata
tcaacagcaagcccctataaatttacaggaagtgtaatgagtgcaattgatgagaagtat
gagggggttaatgactttactttattagaagaaatgcatcaccttattcaaggagctatg
ccaaaagctatggaccaaatagcgacaagacctattaagcataaaaaagtatgtgaagta
caaggtatgaagcaagttgttagtgattttttagtataa

DBGET integrated database retrieval system