KEGG   Cellulosilyticum lentocellum: Clole_1383Help
Entry
Clole_1383        CDS       T01448                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cle  Cellulosilyticum lentocellum
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Clole_1383
Enzymes [BR:cle01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Clole_1383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1576241..1577098)
Genome map
AA seq 285 aa AA seqDB search
MFNTYTNQQFIGCDKPFEEGKVVLFGAPFDGTTSYRPGTRFAPTAIRPDSYGLETYSPYL
DLDLEDFLISDIGDVDVPFGNPPKALAAIKAVAAEIVSHGKKPLMIGGEHLVSLPVIETL
AHHYPDLHIIHLDAHTDLRDDYLGEKLSHATVLRRAWDILGDHRIFQFGIRSGMKQEFEW
AKTHTYLHPFDTVTLKETMQSLKGKPIYFTLDLDVLDPSIFSGTGTPEPGGITMKELLEV
FIILKEAHLIGADVVELAPHYDASGVSTAVACKVIREIALLLANC
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatacttatacaaatcaacaatttattggctgtgataagccttttgaagaagga
aaggtggttttatttggtgcaccttttgatggtactactagctatagacctggtacacgc
tttgcacctaccgctattagaccagattcttacggccttgaaacctactctccctattta
gatttagatttagaagacttcttaattagtgatataggagatgtggatgtaccttttggt
aatccccctaaagctctagcagctatcaaagctgtggcagcagaaatcgtttcacatggt
aaaaaaccccttatgattggtggtgaacatttagtcagcttacctgttattgaaactctt
gcacatcattatcctgatttacatattattcatttagatgcacatacagatttaagagat
gattatttaggagaaaaactttcccatgctactgttttaagacgtgcgtgggatatttta
ggggatcatcgtatttttcagttcggtattcgttctggtatgaaacaagaattcgaatgg
gctaaaacacatacttatttgcatccttttgatactgtcactttaaaagaaacgatgcaa
agcttaaaaggaaagcctatctactttaccctagacttagatgtattagacccttctatt
ttttctggaacaggtacaccagaaccaggtggaatcactatgaaagaacttttagaagtc
tttattatccttaaagaagcgcatcttattggtgccgatgtagtagaattagcacctcat
tatgatgcaagtggtgtttctactgctgtagcttgcaaagtaattagagaaattgcttta
cttttagctaactgttaa

DBGET integrated database retrieval system