KEGG   Cellulosilyticum lentocellum: Clole_1649Help
Entry
Clole_1649        CDS       T01448                                 

Definition
ROK family glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cle  Cellulosilyticum lentocellum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Clole_1649
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clole_1649
   00052 Galactose metabolism
    Clole_1649
   00500 Starch and sucrose metabolism
    Clole_1649
   00520 Amino sugar and nucleotide sugar metabolism
    Clole_1649
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Clole_1649
   00524 Butirosin and neomycin biosynthesis
    Clole_1649
Enzymes [BR:cle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Clole_1649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1855358..1856317
Genome map
AA seq 319 aa AA seqDB search
MYYLGVDLGGTTIKVGLVDENYHILHSISGPTGRERSAEEVLKDMAMLCLEVLKRQGITE
KDIHSIGIGSPGIASPEEGVILSSSNLNFNHVDVRKEIQKYIQTDVYVENDANAAALGEV
ICGAAQGEDNVVVVTLGTGVGGGLVSEGKINRGSFFGAGEIGHQVIRFGDGEPCGCGRKG
CFEQYASATALIRQAKAAAHLYPDSKLISLAKEGLIENINAKVVFDAAQAGDETAERVLE
TYFKYIACGITNIINVLEPSMIVLGGGMSAQKEYLTNPVTKYVQEEMYGGLSLKTKITAA
TLGNDAGIIGAAFLGTTLK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtattatttaggagtggatttaggtgggacaaccattaaagttggtttagtagatgaa
aattatcatattttacacagtataagtggtcctacaggtagagaaagaagtgcagaggaa
gttttaaaagatatggcaatgttatgtcttgaagttttaaaaagacaaggaattacagaa
aaggatatccattcaattggaattggtagtccaggaattgcgtcaccagaagaaggtgtt
attttatcttcaagtaatcttaactttaatcatgttgatgttagaaaagaaattcaaaaa
tatattcaaacagacgtatatgtagaaaatgatgctaatgcagcagcattaggtgaagtt
atttgtggtgcagctcaaggagaagataatgtagtagttgtgacacttggaacaggtgta
ggtggtggacttgtttcagaagggaaaatcaatagaggtagcttctttggagcgggagaa
atcggacatcaagtcattcgttttggtgatggagaaccttgtggttgtggtagaaaaggt
tgctttgagcaatatgcttctgcaacagctctcattcgtcaagcaaaagcagctgcacac
ctttacccagatagcaaattaataagtttagcaaaagaaggtttaatagaaaatattaat
gctaaagttgtatttgatgcagcacaagcaggagatgaaaccgcagagcgagtacttgaa
acctatttcaaatatattgcatgtggtataaccaatattattaatgttttagaaccaagt
atgattgttttaggtggcggtatgagtgcacaaaaagaataccttacaaatcctgttaca
aaatatgttcaagaagaaatgtatggtggtttaagccttaaaaccaaaataacagcagca
actttaggaaatgatgcggggattattggagcagctttcctaggcacaactttaaaataa

DBGET integrated database retrieval system