KEGG   Cellulosilyticum lentocellum: Clole_1807Help
Entry
Clole_1807        CDS       T01448                                 

Definition
phosphoglycerate mutase
Orthology
K02226  
alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
cle  Cellulosilyticum lentocellum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Module
Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Clole_1807
Enzymes [BR:cle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     Clole_1807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2034994..2035587
Genome map
AA seq 197 aa AA seqDB search
MLTLILVRHAATVANEAGLYIGRSESPLSLQGKEEARRLCKKLDKWQIQQIYTSPAERVQ
ETIKELMDKDIPVQVAQALHEINFGICEGKDFNWLKKNYPEEVTYMIKEGIAYRYPKGES
LVMAHQRVADWLNEFLMNHQSGTFLVAAHGGTIRCILSELLVKKPSLHWHFKIDTATITI
VSMNEGFPVIESLNERC
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgcttacattaatactggtaaggcatgccgccactgtagctaacgaagctggcctttat
attggcagaagtgaaagtccgctaagtttacaaggaaaagaagaagctaggaggctttgc
aaaaaactagataagtggcagatacagcaaatttatacaagccctgcagaaagggtacaa
gaaacgataaaagaacttatggataaggatataccagtacaagttgcacaggccttacat
gaaatcaactttggcatctgtgaaggcaaggattttaattggttaaaaaagaattatcca
gaggaagtaacgtatatgattaaggaggggatagcgtatagatatccaaaaggagagagt
ttagtaatggcacatcagagagtagccgactggttaaatgagtttttgatgaatcatcaa
agcggtacttttttagtagcggctcacggtggtacgattagatgtattttatcagagtta
cttgtgaaaaagccttctttacattggcattttaaaattgacacagctactataactata
gtcagtatgaatgaggggtttccagttatagaatcccttaatgagaggtgctaa

DBGET integrated database retrieval system