KEGG   Clostridium lentocellum: Clole_2251Help
Entry
Clole_2251        CDS       T01448                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
cle  Clostridium lentocellum
Pathway
cle00010  Glycolysis / Gluconeogenesis
cle00230  Purine metabolism
cle00620  Pyruvate metabolism
cle01100  Metabolic pathways
cle01110  Biosynthesis of secondary metabolites
cle01120  Microbial metabolism in diverse environments
cle01130  Biosynthesis of antibiotics
cle01200  Carbon metabolism
cle01230  Biosynthesis of amino acids
Module
cle_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cle_M00002  Glycolysis, core module involving three-carbon compounds
cle_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
cle_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clole_2251
   00620 Pyruvate metabolism
    Clole_2251
  Nucleotide metabolism
   00230 Purine metabolism
    Clole_2251
Enzymes [BR:cle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     Clole_2251
Membrane trafficking [BR:cle04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Clole_2251
Exosome [BR:cle04147]
 Exosomal proteins
  Proteins found in most exosomes
   Clole_2251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C PEP-utilizers HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ADZ83960
UniProt: F2JRN9
Position
complement(2475216..2476955)
Genome map
AA seq 579 aa AA seqDB search
MRKTKIVCTLGPATDDEQILRELMLEGMNVARINFSHGTYEKHQQTISLVKKLRQELNLP
VALLLDTKGPEIRIGDFEEREVELKKDQVFTLTTEALKGNETKVSITYNELIKDVSEGMT
ILLDDGLIELKVTSKTNKDIICHVENGGILSSHKGVNIPGAHLSMPFISKQDYSDIVFGI
EQGVDFIAASFTRTAEDIIQIRKILSDYQCNTINIIAKIENRQGIENIDDIIRVSDGIMV
ARGDLGVEVPIEEIPVIQKKIISKVCNAEKPVITATQMLDSMMKNPRPTRAEVTDVANAI
YDGTSAIMLSGETAAGKYPVEALQTMIKITERAEQDINYRQRFKNRDCLTNPDVTNAISH
ATCTTAHDINAAAIITVTKSGKTARMIAKYKPDCPIIGCSTYEYVCRQINLSWGVMPLLI
KEEKNTDDLFEHAAEAVERVGYVKPGEIVVLTAGVPLGIAGTTNLIKVQVIGHILLKGRG
MIHKTVCASLCVCKDEEEVKNDFKPGDILVMPKTSNHIIEELKQAAGLIIEEDGMNSHAA
IVSLSLDIPIILGAQGATEILKSGAIVTLDGETGVVSCN
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaacgaaaatagtttgtacactaggacctgctacagatgatgaacaaatatta
agagagttaatgcttgaaggtatgaatgttgcgcgtatcaatttttcacatggtacttac
gaaaaacatcaacaaactatttcattagtgaaaaagttaagacaagaactgaatttacca
gttgctttattattagatacaaaagggcctgaaattcgtattggtgattttgaggaaaga
gaagtagagcttaaaaaggatcaagtttttacattgacaacagaagcacttaaaggaaat
gaaacaaaagtatcaattacctataacgaacttattaaggatgtttcagaaggcatgacg
attttattagatgatgggcttattgaacttaaagtaaccagtaaaacaaataaagatatt
atttgtcatgttgaaaatgggggaattttatctagtcataagggagttaatattccaggg
gctcatttatctatgccttttatcagcaagcaagattactcagatattgtatttggaatt
gagcaaggtgtagactttatagccgcttctttcacaagaacagctgaggatattatacag
attcggaaaatactaagtgattatcaatgtaataccattaatattattgctaagatagaa
aatagacaaggtattgaaaatatagatgatattattcgtgtatcagatggtattatggta
gccagaggagatttaggggtagaagtacctattgaagaaattccagttattcagaagaaa
attattagcaaggtatgtaatgcagagaaacctgttattactgctacacagatgttagat
tctatgatgaaaaatcctagacctacacgtgcagaagttacagatgttgccaatgctatt
tatgatggaaccagtgctattatgttatcaggcgaaacagcggcaggtaaatatccagtt
gaagcattacaaacaatgattaaaattacagaaagagcagaacaagatattaattataga
cagcgttttaaaaatagagattgtttgactaatcccgatgtaactaacgctatttctcat
gctacttgcacaactgcacatgatattaatgcagcagctattattacagtaacaaaatct
ggtaaaactgctcgaatgattgcaaagtataaaccggattgtcccattattggttgtagc
acatatgaatatgtttgtagacaaattaatttatcatggggtgtcatgccattacttata
aaagaagaaaaaaatacagatgacttatttgagcatgctgctgaagcagttgaaagagta
ggctatgtaaagccaggagaaattgtggtattaacagccggagtacctttaggtatagct
ggaacgaccaatcttattaaggtacaagtcataggacatattcttttaaaggggagagga
atgattcataagactgtttgtgccagcttatgtgtttgtaaagatgaagaagaagtgaaa
aatgattttaaaccgggagatattttagtaatgcctaaaacaagtaatcatattatagaa
gaacttaaacaagctgctggcttaattatagaagaagatggcatgaattcacacgcggct
attgttagtttaagcttagacattcctattattttgggggcacagggagcaactgaaata
ttaaaatctggagcaattgtcacattagatggagaaacgggcgtagtttcatgtaattaa

DBGET integrated database retrieval system