KEGG   Clostridium lentocellum: Clole_2329Help
Entry
Clole_2329        CDS       T01448                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cle  Clostridium lentocellum
Pathway
cle00520  Amino sugar and nucleotide sugar metabolism
cle00550  Peptidoglycan biosynthesis
cle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Clole_2329
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Clole_2329
Enzymes [BR:cle01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Clole_2329
Peptidoglycan biosynthesis and degradation proteins [BR:cle01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Clole_2329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase Pox_VLTF3
Motif
Other DBs
NCBI-ProteinID: ADZ84037
UniProt: F2JSA0
Position
complement(2552510..2553757)
Genome map
AA seq 415 aa AA seqDB search
MSKYVIHGGKRLEGELCIDGSKNAVLPIIAATLLSGNITYLQHCPRILDVEIMIEILKQL
GCKVEWEQENLMIHTSTLQNCDISEELVKKMRSSIILLGALIGRCGEARISQPGGCQLGA
RPIDLHLSALKQMGVHITEQQDTIICKSSNLHGAEISLALPSVGATENIMLAATLAQGNT
TIYNAAKEPEIVDLQDFLVACGANITGAGTEMIKIQGVKKLGGVNYRVIPDRIIAGTYLV
AAAITRGNITLKDIRIEHLDTIIKKLEEVGCHIKASSNEVSLMAPTHLKGIELITEPYPG
YPTDMQSQMMALLCTCESPSRIKENLFEARFKPAYELMKMGAKIHVEDNEAYIMPTHLMG
AKVNATDLRGGAALVLAGLAAEGYSIVNQIHYIKRGYQNIVTDLSSLGAQIQEKE
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtatgttattcatggaggtaagcgtctagaaggtgaactgtgtatagatggc
agtaaaaatgcagttcttcctattattgcagcgactttactaagtgggaatataacttat
cttcaacattgtcctaggatattagatgtggagattatgatagaaatattgaagcaatta
ggttgtaaagtagaatgggaacaagagaacttgatgattcatacaagtactttgcagaac
tgtgacattagtgaagaattagtcaaaaaaatgcgttcgtccattattttactaggagcc
ctaataggaagatgcggggaagcccgtattagtcaaccaggtggttgtcagttaggtgca
agacctattgatttacatcttagtgcattaaagcaaatgggagttcatattacagagcag
caagatacaattatttgtaaaagttcaaaccttcacggcgctgagatttctcttgcttta
ccaagtgtaggagctacagaaaatattatgttagctgctacgcttgcacaaggcaatacg
acgatttataatgcagctaaagaaccagaaattgttgatttacaagattttcttgtggct
tgtggtgccaatattactggagctgggacagaaatgattaagattcaaggagtaaaaaaa
ttaggtggtgttaactaccgtgttattccagatcgtatcatagcaggtacgtatttggtg
gcggcagcaatcaccagagggaatattaccctaaaagacatacgcattgaacatttagat
acaattattaaaaagttagaggaagtagggtgccatattaaggcgagcagtaatgaagta
agtttaatggcacctactcatttaaagggtatagaattaatcactgagccttatccaggt
tatccgacagatatgcaatcgcaaatgatggcactcctttgtacttgtgagtcgccaagt
agaattaaagaaaatttatttgaagcacgttttaaaccagcttatgaattaatgaagatg
ggtgctaaaattcatgtggaagacaatgaggcttatattatgcctacacatttgatggga
gcaaaggttaatgctactgatttaagaggaggggcggcgcttgttttagcgggcctagct
gcagaaggttatagcattgtaaatcaaatccactatatcaaaagaggctatcaaaatata
gtaactgatttaagctctctaggtgcacagatacaagagaaggagtag

DBGET integrated database retrieval system