KEGG   Cellulosilyticum lentocellum: Clole_2334Help
Entry
Clole_2334        CDS       T01448                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cle  Cellulosilyticum lentocellum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Clole_2334
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Clole_2334
Enzymes [BR:cle01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Clole_2334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2558759..2560210)
Genome map
AA seq 483 aa AA seqDB search
MELSKLLTGLNYVCVKGNEHQEVDHMIYDSRIKTNAGLFIAIEGFKTDGHQFIEAAIANG
AKAILVQKDVEIKEDVTIIKVEDTRLAMALVANNAYGHPSKQFELVGVTGTNGKTSITFL
LGQILEAYHKKIGIIGTIENRIGSQILKAERTTPESLDLQALFKKMVESQVDTTLMEVSS
HALALSRVAGSDFKVGIFTNLTQDHLDFHQTMENYAAAKAKLFTMCETGIVNKDSDYINE
IIKGATCNLVTYAIDKDADYKATNVIITAAGVEYTLVCDQGTFKVDVPIPGKFTVYNTLA
VIAAARALEIPMTHILATLKIAKGVPGRVQAFKSIKGYSVLVDYAHTPDGLENVLSTIKE
FAQGHIITVFGCGGDRDKTKRPIMGKIAATYSDHVFITSDNPRTEDPLLILDEVEVGVKA
ITDNYVKVEDRKAAIEMALSEAKAEDVVLIAGKGHENYQILKDRIIHFDDSEIVNAYLQG
EIE
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggaactaagtaaactattaacgggactaaattatgtatgtgtaaaaggtaacgaacat
caggaagttgaccatatgatttatgattcacgtatcaagacaaatgcgggattatttatt
gctatagagggatttaaaaccgatggccatcaatttattgaggcggccattgcaaatggt
gcaaaagctattttagtacaaaaagatgtagagataaaagaagatgttacaatcattaag
gtggaggatacaaggctagctatggcattagtagcgaataatgcctatggacatccatca
aagcaatttgaacttgtaggtgtaacaggaactaatggtaaaacaagtattactttttta
ttaggacagattttagaagcttatcataaaaaaataggaattattggaacgattgaaaat
cgtataggaagtcaaattttaaaagctgagcgtacaacacctgaatctttagatttacaa
gctttatttaaaaagatggtagaaagtcaagtagacacaactttaatggaagtttcttca
catgctttagcattaagtcgtgtagcaggttctgattttaaagtgggtatatttacgaat
cttactcaagatcatttagattttcatcaaacgatggaaaattatgctgcagctaaagca
aagctttttactatgtgtgaaacaggtattgttaataaagatagtgattatataaacgaa
attattaaaggtgctacatgtaatcttgtaacgtatgccattgacaaggatgcagattac
aaagcaacaaatgtaataataactgctgcaggtgtagaatatactttagtgtgtgaccag
ggaacctttaaggttgatgtgcctattccaggtaaatttactgtttataatacattagca
gttattgcagcagcccgtgcattagaaattccaatgacacatattcttgcaacgttaaaa
atagcaaaaggtgttcctggcagggtgcaagcttttaaatctatcaaaggttatagtgta
ttagttgattatgcgcatacacccgatggcttagaaaatgttttatcaactataaaagaa
tttgcacaaggtcatattatcacagtatttggctgtgggggagatcgtgataaaacaaag
aggccaattatgggaaaaattgctgctacttattccgatcatgtttttattacctctgat
aacccaagaactgaagatccgcttctaatcttagacgaagtagaagtaggtgttaaggca
ataacagataattatgttaaagttgaagatcgtaaggctgctattgaaatggcattaagt
gaagcaaaagctgaagatgttgtactgattgcaggcaaaggtcatgaaaattatcaaatt
ttaaaagatagaattatccactttgatgatagtgaaattgttaatgcgtatctacagggg
gaaatagaatga

DBGET integrated database retrieval system