KEGG   Clostridium lentocellum: Clole_2383Help
Entry
Clole_2383        CDS       T01448                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cle  Clostridium lentocellum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cle01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cle00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2619448..2620242)
Genome map
AA seq 264 aa AA seqDB search
MRASVKAAKRIIIKIGTSSLTHENGKVNLDKMEKLARVLTDLNNSGKEIVLVSSGAIGAG
MQRIGRNKRPEDLPLKQATAAIGQAILMKMYQKFFDEYNQVIAQILLTKDVIEDPIKSNN
AKNTFETLLDLGVIPIINENDCISTAQIEGYRFGDNDTLSATVAELIHADLLILLTDIEG
LYTANPKEDAEATLIPQVDDITEDVKALAGGSGSHLGTGGMITKIIAAEIAKACGTETIV
ASGEEIEILREILRGEAIGTWFTA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagagcaagtgtaaaagctgcaaaacgtataattattaaaataggtacatcgtcttta
acccatgaaaatgggaaagttaacttagataaaatggaaaagctagcacgtgttttaaca
gatttaaataactccggaaaagaaatcgttttagtttcttcaggagctattggcgctgga
atgcagcgtattggtcgcaataaaagaccagaagacttacctttaaaacaagctacagca
gccattggacaagctatcttgatgaaaatgtatcaaaagttctttgatgaatataatcaa
gtcattgcacaaatactactgacaaaagatgttattgaagaccctattaaaagtaacaat
gctaaaaatacatttgaaacgttattggatttaggtgtcatccctattattaatgaaaat
gactgtatatctacagctcaaattgaaggttatcgttttggagataatgataccttatca
gctacagttgcagagctcattcatgcggaccttttaattttacttacagatattgaggga
ctatatactgctaatcctaaagaggatgcagaggctacgcttattccacaggtggatgat
attactgaggatgtcaaagcattggctggaggttcaggttctcatctaggaacaggtggc
atgattactaaaattatagcagctgaaatagcgaaggcttgtggtactgaaacgattgtg
gcttctggtgaagaaatagaaatcttaagagagatactacgtggtgaagccataggaacg
tggtttactgcttaa

DBGET integrated database retrieval system