KEGG   Cellulosilyticum lentocellum: Clole_2476Help
Entry
Clole_2476        CDS       T01448                                 

Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cle  Cellulosilyticum lentocellum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Clole_2476
Enzymes [BR:cle01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Clole_2476
Exosome [BR:cle04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Clole_2476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2705852..2708425)
Genome map
AA seq 857 aa AA seqDB search
MGNDNLLMEKQFELLEQGTLATPHSILGPHLLNQGEKQIIRVFCPGAKQIVVVDLKDEKN
YPLYFKGYQGLFEGVIEDKQEKFLYKLICEDDEGHTWSYIDPYQFDSTFTEDDLYLFGIG
KDYEVYDKLGAHFIKVNGVEGVRFALWAPHAKRVSVIGDFNNWDGRRHPMRQIANQGIWE
LFVPGLAEGDLYKFELRTKTGELLYKTDPYANYYEVRPNNAAVVYDMRKYKWKDTKWMNA
RTKKAPYKEAVSIYEVHIGSWKKHDNGEFYTYREAADELAHYVKEMGYTHVELMGIVEHP
FDGSWGYQVTGYFAPTSRYGSPDDFRYFVEMMHKNNIGVLLDWVPAHFPKDAFALEKFDG
EALYEKANEKEAWHPHWGTLIFDYGKPQVSLFLIGSALSWLECYHIDGLRVDAVASMLYL
DYGREGDFIPNQYGGKENLEAIAFLKQLNEVAYSKVPGIMMIAEESTAWPKVSYAVSEGG
LGFGFKWNMGWMNDFLSYMKTPPADRTREHGKITFSLMYAFSENFIQVLSHDEVVHGKAS
MIYKMPGERLEKFAHLRVAYGYMYAHPGKKMLFMGDEFAQTKEWNEAVALDWDLLNDKEH
QGISAWVKALNKLYTSEKALWETGNGYENFEWIDCENREQSIISFLRRNVETGEELVVVI
NFKTASYTDYRIGVPTLANYEELLSSDAALYGGSNALNGVVKATETGWHGRPYSIEITIP
PLSMMVFKAKKKSVKKNTKSVKSATDKDMKEVATEVVANAIPAKKTIKSKKDKEIEKAVV
LPKTKETKAKDAKAKETKSKETKTKDTKTKETKTKVKQQASNKTEEIIVKEKASPLVSTE
EKKTAGKTKKNVSKAKK
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgataatttattaatggaaaaacaatttgagttattagaacaaggcacctta
gctacaccacatagtatacttggtccacatttgcttaatcaaggagaaaaacagattata
cgtgtattttgcccaggggcgaaacaaatagtagtagtagatttaaaggatgagaaaaat
tatccgctttactttaaggggtatcagggactttttgaaggcgttatagaagataagcaa
gaaaaatttttatataaactcatatgtgaagatgatgaggggcacacatggagttatata
gatccttatcaatttgattctacttttactgaagatgatctttatttatttggaatagga
aaagactacgaggtttatgataaactgggcgcacattttataaaagtgaatggcgtagag
ggggttagatttgcattatgggcacctcatgctaagcgtgtcagtgtgataggagatttt
aataattgggatggtagaagacatccaatgagacagattgccaatcaaggtatttgggaa
ctttttgttccagggcttgctgaaggggatttatataaatttgaactgcgtactaaaaca
ggggaactattatataaaacagatccttatgccaattattatgaagttagacctaataat
gcagcggttgtttatgatatgagaaaatataagtggaaagatacgaaatggatgaatgct
agaactaaaaaagcaccttataaagaagccgtatccatttacgaagtacatattggttca
tggaagaaacacgataatggagagttctatacttatcgtgaagcagcagatgaacttgct
cattatgtgaaagaaatgggttatacacatgttgaattaatgggaattgtagaacatcct
tttgatgggtcatggggataccaagtaacaggctattttgcgccaaccagtaggtacggt
tcaccagatgattttagatactttgtagaaatgatgcacaagaataatattggtgtttta
ttagattgggtaccagcacactttcccaaagatgcatttgccttagaaaaatttgatggt
gaagccctatatgaaaaagcaaatgagaaagaagcatggcatccacactggggaacactt
atttttgattatggaaaaccacaagtgtcactctttttaattggcagtgctctttcttgg
ttagaatgttatcatatagatggacttcgagtagatgctgttgcttcgatgttatattta
gattatggaagagaaggggattttattccaaatcaatatggaggcaaggaaaatttagaa
gctattgcttttttaaaacagctcaatgaggtagcttattcaaaagtaccaggtattatg
atgattgcagaggaatctacagcttggccaaaagtatcgtatgcagtatctgaaggtgga
cttggctttggatttaagtggaatatgggatggatgaatgactttttgagttacatgaag
acgcctccagctgatcgtacaagagaacatggcaagattacctttagtttgatgtatgct
tttagtgaaaattttattcaagtcttatcgcacgatgaagttgttcatggtaaagcgtct
atgatttataagatgccaggagaaaggcttgaaaaatttgctcatttaagagtggcatat
ggttatatgtatgcacatcctgggaaaaagatgttatttatgggagacgaatttgcacaa
actaaagaatggaatgaagcggttgctttagattgggatttattaaatgataaagaacat
caaggcatttcagcgtgggtgaaagcacttaataagctatatacatctgagaaggcttta
tgggaaactggcaatggctatgagaattttgaatggattgactgtgaaaatagagaacag
agtattatttctttcctacgaagaaatgtagaaacaggggaagaacttgtagtggttatt
aactttaaaacagcaagttacacagactatcgaataggggtacctacactggcaaattac
gaggaactattaagtagtgatgcagcactttatggtggtagtaacgcgcttaatggcgtg
gtaaaagctacagaaacaggatggcatggtagaccctatagtatagaaatcactataccc
ccacttagtatgatggtatttaaggcaaagaaaaaatcagtaaagaagaatactaaatca
gtgaaatcagctacagataaagatatgaaagaggtagctacagaagtagtcgcaaatgca
ataccggctaaaaaaacaattaaatcaaagaaggacaaagaaatagaaaaagcagtagtg
ctaccaaagactaaagaaacaaaggctaaagatgcaaaagccaaagaaactaagtctaaa
gaaacaaaaaccaaggatacaaaaactaaagaaacaaaaactaaagtaaagcagcaagct
tctaataagactgaggaaataatcgtcaaagaaaaggcttctcctttagtaagtacagaa
gaaaagaaaacagctggtaaaacaaagaaaaatgtaagtaaagctaaaaagtaa

DBGET integrated database retrieval system