KEGG   Clostridium lentocellum: Clole_2489Help
Entry
Clole_2489        CDS       T01448                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
cle  Clostridium lentocellum
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cle01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:cle00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2725047..2726348)
Genome map
AA seq 433 aa AA seqDB search
MIQIIETIEAKEAFLKKLEVRGNMDTGEYALAAKKIVDRVRSEKDAALFEYTAMWDCPEI
HAGNVKVSVEDMKAAYDTLEPELQEAITLSAARIESFHQKQKQNTWIDVKENGEILGQRV
TPLEKVGVYVPGGKAAYPSSVLMNVIPAKVAGVERIVMVTPASKDGQLTKEVLAAAYIAG
VTEVYKIGGAQAIAALAFGTETIPKVDKIVGPGNIYVTLAKREVFGYVNIDSIAGPSEIL
IVADESANPTFVAADLLSQAEHDQLASAVLITTSKALAEKVQKEVARFYEIMPRQEILSA
SLANYCAIVIEPSMESACELANAIAPEHLELAVTAPFEVLTRIKNAGAIFLGHYTPEPVG
DYMAGPNHVLPTNGTARFFSPLGVDDFIKKSSILSFTKEALMPIGKSIVRFAESERLFAH
ALSVQVRLDEEVK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaatcatagaaaccatagaagcaaaagaagcttttttgaagaaacttgaagta
agaggcaatatggatacaggggaatatgctttagctgctaaaaaaatagtagatcgtgta
cgtagtgaaaaagatgctgctcttttcgaatatacagccatgtgggactgcccagagatt
catgcaggtaatgtcaaggtaagtgtagaagatatgaaagctgcttatgataccttagaa
cctgagcttcaagaagccattacactttcagcagcgcgtattgaaagcttccatcaaaag
caaaaacaaaacacatggattgatgtgaaagaaaatggtgaaatattaggccaacgcgtc
acacctctagaaaaagtaggcgtatatgtaccaggaggcaaggcagcttatccttcttct
gtattaatgaatgtgattcctgcaaaggtagctggcgtagagcgtattgtgatggtaaca
ccagcttctaaggatggtcagttaactaaggaagtgttagcagctgcttatattgcaggg
gtgacagaagtttataaaattggaggggcacaagccatagccgccctcgcttttggaact
gagacgattccaaaggtggacaaaatagtagggccaggcaatatttatgtgactttagct
aaaagagaagtatttggttatgtgaatattgattcgatcgcaggaccgagtgaaatttta
atcgtggctgatgaaagtgctaaccctaccttcgtagcagcagacttattatcacaagca
gagcatgatcagctagcttcagcagtgcttattacaactagcaaagcattagcagaaaaa
gtacaaaaagaagtggcacgcttttatgaaatcatgccacgccaagagattttaagtgct
tctttagcaaactattgtgccattgtgattgagcctagtatggaaagtgcctgtgaactt
gccaatgccattgcaccagaacacctagaactagcagtaacggcaccttttgaagtttta
acacgtattaaaaatgcaggggctattttcttaggccattatacaccagaaccagtaggt
gactatatggcaggtcctaatcatgttttacctactaatggtactgctagatttttctca
cctttaggggtagatgattttattaaaaaaagcagtattttatcttttacaaaagaagcc
ttaatgccgatcggaaaatcaattgtacgttttgcagaaagtgaaagattatttgctcat
gcattatcagttcaagttcgtttagatgaggaagtgaaataa

DBGET integrated database retrieval system