KEGG   Cellulosilyticum lentocellum: Clole_2600Help
Entry
Clole_2600        CDS       T01448                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cle  Cellulosilyticum lentocellum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Clole_2600
   01230 Biosynthesis of amino acids
    Clole_2600
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clole_2600
   00030 Pentose phosphate pathway
    Clole_2600
   00051 Fructose and mannose metabolism
    Clole_2600
   00052 Galactose metabolism
    Clole_2600
  Energy metabolism
   00680 Methane metabolism
    Clole_2600
Enzymes [BR:cle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Clole_2600
Protein phosphatases and associated proteins [BR:cle01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Clole_2600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2853031..2854290
Genome map
AA seq 419 aa AA seqDB search
MNRRGNCIIGQSGGPTAAINASLSGVLQGILENDLYSNVYGMVNGIEGLLQGKYLDLSAK
FQTKEELDRLTHTPSMYLGSCRFKLPTCEHSEVVYRDLFRFFEAHNIKTVFYIGGNDSMD
TVLKLSDYAKAHHYDVNVIGIPKTIDNDLPITDHTPGFGSAAKFVATSLLEIAHDTYIYN
IPSVTIVEIMGRNAGWLTAAAALARNSYSMAPDLIYLPEAVFDKERFIEDVKAIKEKRKN
VIIAVSEGIKDSEGQYISASTSAVDSFGHKQLCGVGKTLENLLKAELGCKVRSIELNVLQ
RAGGHIASLTDLEEAVMIGKTAATLGAQGETAKMICYKRLQNSPYQVETFAYDIHSIANG
EKTVPLEWINETQNDVTSDLIDYLMPLIQGEVSLSFTSGIPNYCNIDHLFTPGYFKEHK
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaagagggaattgtattattggacaatctggtggccctacagctgccattaac
gcctcgctcagtggtgtattacaaggtattttagaaaatgatctttattctaatgtatac
ggtatggtcaacggtattgaaggtctattacaaggcaaatacttagacttatcagccaaa
tttcaaaccaaggaagaacttgacaggctaacacatacgccatctatgtatcttggttct
tgccgttttaaattaccgacttgtgaacattcagaagtcgtttatcgtgatttattccgc
ttctttgaagcccacaatattaaaactgttttttatatcggtggtaacgattcaatggat
acggttttaaaactgtcggactatgctaaagcacatcactatgatgtcaatgttattggt
attccaaaaacaattgataatgatttaccgattacagatcacacaccaggtttcggaagt
gctgctaagtttgtagcgacttcacttttagaaattgcgcatgatacctatatttataac
attccttctgtaaccattgttgaaattatgggaagaaatgcaggttggcttactgcagct
gctgcccttgcacgtaatagttattcgatggctcctgatttaatttatttaccagaagct
gtttttgataaagaacgttttattgaagatgttaaggctattaaagaaaaaagaaaaaat
gtcattatagctgtttcagaagggattaaagatagcgaaggccaatacatttctgcttct
actagcgcggtagactcttttggtcacaaacaattatgcggtgtaggtaagaccctagaa
aatctccttaaagcagaactgggctgtaaagtacgttctattgaactgaatgttcttcaa
cgtgccggtggacatattgcttctcttactgatctcgaagaagctgttatgattggtaaa
acagctgctactttaggtgctcaaggtgaaacagctaaaatgatttgctacaaacgtctt
caaaatagtccttatcaagtagaaacctttgcttatgatattcattctattgctaatggg
gagaaaacagttcctttagaatggattaatgagactcaaaacgatgtgacatctgacctt
atagactacttaatgccccttatccaaggcgaagtctcattaagctttacttcaggcatt
cctaactactgcaacattgaccacttatttacacctggctattttaaagaacacaaataa

DBGET integrated database retrieval system