KEGG   Clostridium lentocellum: Clole_2600Help
Entry
Clole_2600        CDS       T01448                                 

Definition
(GenBank) Diphosphate--fructose-6-phosphate 1-phosphotransferase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cle  Clostridium lentocellum
Pathway
cle00010  Glycolysis / Gluconeogenesis
cle00030  Pentose phosphate pathway
cle00051  Fructose and mannose metabolism
cle00052  Galactose metabolism
cle00680  Methane metabolism
cle01100  Metabolic pathways
cle01110  Biosynthesis of secondary metabolites
cle01120  Microbial metabolism in diverse environments
cle01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clole_2600
   00030 Pentose phosphate pathway
    Clole_2600
   00051 Fructose and mannose metabolism
    Clole_2600
   00052 Galactose metabolism
    Clole_2600
  Energy metabolism
   00680 Methane metabolism
    Clole_2600
Enzymes [BR:cle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Clole_2600
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Clole_2600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ADZ84303
UniProt: F2JID7
Position
2853031..2854290
Genome map
AA seq 419 aa AA seqDB search
MNRRGNCIIGQSGGPTAAINASLSGVLQGILENDLYSNVYGMVNGIEGLLQGKYLDLSAK
FQTKEELDRLTHTPSMYLGSCRFKLPTCEHSEVVYRDLFRFFEAHNIKTVFYIGGNDSMD
TVLKLSDYAKAHHYDVNVIGIPKTIDNDLPITDHTPGFGSAAKFVATSLLEIAHDTYIYN
IPSVTIVEIMGRNAGWLTAAAALARNSYSMAPDLIYLPEAVFDKERFIEDVKAIKEKRKN
VIIAVSEGIKDSEGQYISASTSAVDSFGHKQLCGVGKTLENLLKAELGCKVRSIELNVLQ
RAGGHIASLTDLEEAVMIGKTAATLGAQGETAKMICYKRLQNSPYQVETFAYDIHSIANG
EKTVPLEWINETQNDVTSDLIDYLMPLIQGEVSLSFTSGIPNYCNIDHLFTPGYFKEHK
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaagagggaattgtattattggacaatctggtggccctacagctgccattaac
gcctcgctcagtggtgtattacaaggtattttagaaaatgatctttattctaatgtatac
ggtatggtcaacggtattgaaggtctattacaaggcaaatacttagacttatcagccaaa
tttcaaaccaaggaagaacttgacaggctaacacatacgccatctatgtatcttggttct
tgccgttttaaattaccgacttgtgaacattcagaagtcgtttatcgtgatttattccgc
ttctttgaagcccacaatattaaaactgttttttatatcggtggtaacgattcaatggat
acggttttaaaactgtcggactatgctaaagcacatcactatgatgtcaatgttattggt
attccaaaaacaattgataatgatttaccgattacagatcacacaccaggtttcggaagt
gctgctaagtttgtagcgacttcacttttagaaattgcgcatgatacctatatttataac
attccttctgtaaccattgttgaaattatgggaagaaatgcaggttggcttactgcagct
gctgcccttgcacgtaatagttattcgatggctcctgatttaatttatttaccagaagct
gtttttgataaagaacgttttattgaagatgttaaggctattaaagaaaaaagaaaaaat
gtcattatagctgtttcagaagggattaaagatagcgaaggccaatacatttctgcttct
actagcgcggtagactcttttggtcacaaacaattatgcggtgtaggtaagaccctagaa
aatctccttaaagcagaactgggctgtaaagtacgttctattgaactgaatgttcttcaa
cgtgccggtggacatattgcttctcttactgatctcgaagaagctgttatgattggtaaa
acagctgctactttaggtgctcaaggtgaaacagctaaaatgatttgctacaaacgtctt
caaaatagtccttatcaagtagaaacctttgcttatgatattcattctattgctaatggg
gagaaaacagttcctttagaatggattaatgagactcaaaacgatgtgacatctgacctt
atagactacttaatgccccttatccaaggcgaagtctcattaagctttacttcaggcatt
cctaactactgcaacattgaccacttatttacacctggctattttaaagaacacaaataa

DBGET integrated database retrieval system