KEGG   Clostridium lentocellum: Clole_2811Help
Entry
Clole_2811        CDS       T01448                                 

Definition
(GenBank) Pectinesterase (EC:3.1.1.11)
  KO
K01051  
pectinesterase [EC:3.1.1.11]
Organism
cle  Clostridium lentocellum
Pathway
Pentose and glucuronate interconversions
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Clole_2811
Enzymes [BR:cle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Clole_2811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3042315..3044504)
Genome map
AA seq 729 aa AA seqDB search
MNKRLRRYVHLALASLIAVSSVSVTFASEFIVNESFDNMILGAAPSGYEVSDSVAITTVD
LNNDRNYCVYLNDGEGQLKMNKQFAAQSEVVTLSVDFMQNNLGSGTHINLTDGTGLRAVR
LETRDNGTSLNYVMNGTYVKVADITSGEWMTIKIEANIKTQTFNIYINDILKGKDIPFKN
TVSEISYFQTLTPADKVSGHYIDNLSISASKAPVTIPEDATEITFTVNANGQGDFKTVQE
AIDAIPSATTLPATIHIKAGTYKEVVTIPKSVKNLTLIGEGSEQTILTYDNYNAKLKEDG
TPYGTGDSASTFIKGSNISVEGITFENSFQETGANGEQAVALSVTGNNVQFRNCRFLGNQ
DTLLLDGGTQYFTNCYIEGDVDFIFGRSQAVFEDSEIHSLNRGSSSNNGYIVAPRTSIDE
AYGFAFMNCKLTAEEGTANNSVYLGRPWTPSGMSVDKPSAAFINCEMGAHIKTEPWTSMS
GTPASHGRFFEYNSSGEGAVINASRPQLTQTEVANWTITNVLKGWEPSFSIKEEVKPEEP
EVTPPVIEKIYFTDVTSTDAYYDDIMFLANNGYVEGVGNGQFAPLMEMTRSQFATILSRV
LNLTTSSTTSAFTDVKPNAWYFNGIQACYEAGLIKGVSATSFAPNDKISKQDMMLLLSRA
ITYLNIQLDETQSDIQFIDQANISAYALDGIKICIQAGILKNEGYFIPKNVVTRADMATM
FAKLIRLAN
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaagattaagacgttatgttcaccttgctttggcaagtcttattgctgtcagt
agcgtttctgtaacttttgcctctgaattcattgttaatgaatcttttgataatatgatt
ttaggcgctgccccaagtggttatgaagtttcagatagcgtagctattacgacagttgat
ttaaataatgatagaaactactgtgtttacctcaatgatggggaaggacagcttaaaatg
aataaacaatttgctgctcaatcagaggtagtgacactatctgttgattttatgcaaaac
aacctaggaagcggtacacatattaatttaacggatgggacaggtttacgtgctgttcgt
cttgaaacacgtgacaatggtacttctcttaactatgtgatgaatggcacttatgttaaa
gttgctgacattacgtcaggcgagtggatgactattaaaatcgaagctaatataaaaact
caaacttttaatatctatattaatgacattttgaaaggtaaagatattcctttcaaaaac
actgtttctgaaatcagttatttccaaacccttacgccagcagataaagtaagtggacat
tatattgataacctgagcatttctgcaagtaaagcacctgttacgattccagaggatgct
actgaaattacgtttacagtaaatgctaatggacaaggtgatttcaaaacagtacaagaa
gcaattgatgctattccttcggctactactcttcctgcaaccatccatattaaagctgga
acctacaaggaagtcgttacgattcctaaatcagttaaaaatcttacccttattggagag
ggcagtgagcaaacgattttaacttatgataattataatgcaaaacttaaagaggatggc
acaccttatggtacaggcgacagtgcaagtacttttattaaaggtagtaacatcagtgta
gaaggaattacttttgaaaacagttttcaggaaactggggcaaatggtgaacaagctgtt
gcacttagtgttactggaaataatgttcagtttagaaactgccgtttccttggtaatcaa
gatacgctccttttagatggtggtacacaatactttaccaattgttacattgaaggcgat
gtagactttatctttggtagaagtcaggccgtttttgaagacagtgaaattcattcctta
aatcgaggaagttcatcgaataatggttatattgtagccccaagaacaagtattgatgaa
gcttatggatttgcttttatgaattgcaaactcaccgctgaagaaggaacagcaaataac
tctgtttacttaggtcgtccttggacaccaagtggtatgagtgtagataagccaagtgct
gctttcattaactgtgaaatgggtgctcatattaaaacagaaccttggactagcatgtct
ggtacaccagcttctcatggccgtttctttgaatacaacagtagcggagagggagctgtg
atcaatgcctcaagacctcaattaacacaaacagaagtagctaattggaccattaccaat
gtccttaaaggatgggaaccttctttctctattaaagaagaagtgaaacctgaagagcca
gaagtaactcctccagtgattgaaaaaatctactttactgatgtgacttctactgatgct
tattatgatgatattatgttccttgccaataatggttatgtagaaggggttggaaatggc
cagtttgcgccacttatggaaatgacacgttctcaatttgctactattttaagccgtgtc
cttaaccttacaacctctagtacaacaagtgcttttactgatgttaaaccaaatgcttgg
tactttaatggaattcaagcgtgttatgaagctggtcttatcaaaggggtaagtgccaca
tcctttgcaccaaatgataaaattagtaaacaggatatgatgctccttctttctagagct
ataacttaccttaatatacaactagatgaaacgcaaagcgatattcagttcatcgatcaa
gcaaatatttcagcttatgcccttgatggcattaaaatctgtattcaggcaggtatctta
aaaaatgaaggttacttcattccgaaaaatgtagtcacaagagctgatatggcaactatg
ttcgctaaactcatccgtttagccaattaa

DBGET integrated database retrieval system