KEGG   Clostridium lentocellum: Clole_2833Help
Entry
Clole_2833        CDS       T01448                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cle  Clostridium lentocellum
Pathway
cle00010  Glycolysis / Gluconeogenesis
cle00051  Fructose and mannose metabolism
cle01100  Metabolic pathways
cle01110  Biosynthesis of secondary metabolites
cle01120  Microbial metabolism in diverse environments
cle01130  Biosynthesis of antibiotics
cle01200  Carbon metabolism
cle01230  Biosynthesis of amino acids
Module
cle_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cle_M00002  Glycolysis, core module involving three-carbon compounds
cle_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clole_2833
   00051 Fructose and mannose metabolism
    Clole_2833
   00562 Inositol phosphate metabolism
    Clole_2833
Enzymes [BR:cle01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Clole_2833
Exosome [BR:cle04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Clole_2833
  Exosomal proteins of bladder cancer cells
   Clole_2833
  Exosomal proteins of melanoma cells
   Clole_2833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF4154
Motif
Other DBs
NCBI-ProteinID: ADZ84532
UniProt: F2JKZ1
Position
complement(3065264..3066007)
Genome map
AA seq 247 aa AA seqDB search
MRKKIVAGNWKMNMTPAKAVELINSLKNEINTTDVDVVVCPPFVCLPAVLDAVKGTNIAV
GAQNMHFEENGAYTGEIAPSMLVELGVKYVIIGHSERRQYFAETDVTVNKKVLKAIEHNL
VPILCVGESLEEREQGITIDLVRLQTKVALKDVKAEDAKKVVIAYEPIWAIGTGKTATSA
QAEEVCKAIREVVAEVYGQEVADEVRVQYGGSVNAGNANELFNMGNIDGGLVGGASLKAE
FTSIVNY
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaaaaatcgttgctggtaactggaaaatgaacatgactccagctaaagctgta
gaacttatcaattctttaaaaaatgaaatcaatacaactgatgttgacgtagtagtatgt
ccaccatttgtatgccttccagctgtacttgatgcagttaaaggaacaaacattgctgta
ggtgcacaaaacatgcactttgaagaaaatggtgcttatacaggtgaaatcgctccaagc
atgcttgtagagcttggtgttaaatatgtgattattggtcactcagaaagaagacaatat
ttcgctgaaacagatgtaacagttaataaaaaagtattaaaagctattgagcataactta
gtaccaatcctttgtgttggtgaaagtttagaagaaagagaacaaggcattacaatcgac
cttgtacgtcttcaaacaaaagttgctcttaaagatgtaaaagcagaagatgctaaaaaa
gtagtaattgcttatgaaccaatctgggcaatcggaacaggtaaaacagctacttcagct
caagctgaagaggtatgtaaagccattagagaagtagttgctgaagtttatggacaagaa
gttgctgatgaagtacgtgttcaatacggcggtagcgtaaatgctggtaatgcaaatgaa
ttattcaacatgggtaacattgatggtggccttgttggtggtgcttctcttaaagctgaa
tttacttcaatcgttaactactaa

DBGET integrated database retrieval system