KEGG   Cellulosilyticum lentocellum: Clole_2843Help
Entry
Clole_2843        CDS       T01448                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cle  Cellulosilyticum lentocellum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Clole_2843
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Clole_2843
Enzymes [BR:cle01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Clole_2843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3077625..3078902)
Genome map
AA seq 425 aa AA seqDB search
MKRYIRIFLLIMVLLVVGCTNSDSSLKESVASDEIKEKTDEVEKQSNQKLNEEQKEDTPK
ASIREEEQEVKETITLEEKIEAYMQQMTIEEKIGQLFMIAIRKDQQGEPITQMNEEVKKL
LTTYPVGGIILFKENIVTAKQTQELISDLQAMSTIPLFIGVDEEGGSVSRVGSNSQINEV
PFKIAFSIGETGDPELAYKEATRMGKLLKSLGFNMNFAPVADIYNEPGNTVIGKRSFGET
AETVTPMVIRFAEGLIQEGIQPVLKHFPGHGNTLEDSHEGLAYINKSLEELELEELIPFT
KALESGVGALMRGHLMVKTVDDSLPASLSPIWGNYILAHYDCDNILLMTDAMDMGAIQNQ
YSVEEAALLCIEAENDICLMPADIGKAYTALVEGYKEGRLTEERINRSVRKILSKKVAQN
SLVLE
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagatatattcggatatttttgttaatcatggtattgctagtagtaggctgtaca
aatagtgatagtagcttaaaggaaagcgtagcatcagatgaaataaaggagaagacagat
gaggtagaaaagcaatctaatcaaaagcttaatgaggagcaaaaagaagatacaccaaaa
gcaagtataagggaagaagaacaagaagtgaaagaaacaataacgctagaagaaaaaata
gaagcttatatgcagcaaatgactatagaagaaaaaataggacaactttttatgattgcc
attcgtaaagatcagcaaggagagccaatcactcaaatgaatgaagaagtaaaaaagctt
cttactacttatccggtaggcggcattattctttttaaagaaaacatagtaacggcaaaa
cagacacaagaacttattagtgatctacaagcaatgagcaccattcctctatttataggt
gtagatgaagaaggagggagcgtgagcagggtaggaagtaatagtcaaataaatgaagtt
ccttttaaaatagcttttagtataggagaaacaggagatcctgagttagcttataaagaa
gctacaaggatggggaaactcttaaaaagcctaggatttaatatgaattttgcacctgta
gcagatatttataatgaacctggtaatacagtgattggaaaaagaagctttggagaaaca
gcggagactgtcacacctatggtgattcgtttcgcagaaggtttaattcaggaagggatt
caacctgtactgaagcatttcccgggacatggtaatacccttgaggattctcatgaagga
ttagcttatattaacaagagtctagaagagctagagttagaggagctcattccctttaca
aaagcacttgaatcaggagtaggagctttaatgagaggacacctaatggtgaaaacagta
gatgatagtctacctgcttctttgtcacctatatggggaaattatatcttagcgcattat
gattgtgataacattttattaatgacagatgctatggatatgggagctattcaaaatcaa
tattcagtagaagaagcagcgctgctttgtatagaggcggaaaatgacatttgtttaatg
ccggctgacataggaaaagcttatactgctcttgtggaaggctataaagaaggaagattg
acggaagaaagaattaatcgttcagttagaaaaattttgtcaaaaaaagtggcacaaaat
agtcttgtacttgaataa

DBGET integrated database retrieval system