KEGG   Clostridium lentocellum: Clole_2943Help
Entry
Clole_2943        CDS       T01448                                 

Definition
pullulanase
Orthology
K01200  
pullulanase [EC:3.2.1.41]
Organism
cle  Clostridium lentocellum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3184429..3187524)
Genome map
AA seq 1031 aa AA seqDB search
MKKKYVGIVLVCILILNLFQGILPLEATPNTEKQLIIHYYRPDKQYEEWNLWMWLDGKDG
NVTEFTEEDEFGVKAIIPLEETANKVGFIVRTNDWAKDVSDDRFVATTEAINEIWLVSGD
ETIYTEEPNLLGGTVILPEQVTLNVHYNRYDRNYEDWKLWLWPEGKEGISYNFEKEDAYG
KVATFTVKDIGSIRKLGFWLYKKDVQNKDVEIDRFISTTKVDENGKIDIYLKQGEEKVGY
SKEEMYIKPSVSWATMDTMESICLGVNVPFETKEDLKADFSVTKAGKKIAINKVELLDEM
EGGLAKGAKLYLAETIDFNGIYEVAKEGYEAKIATAGEIFNTEAFNQLYYYEGDDLGANY
QKERTAFKLWAPTASEVEVILYDAGNDGKVLQEVPMTKQEKGTWSATIQGDQNAVYYTYK
VRINGEWREVVDPYARTTGVNGMRAMVIDLAETNPEGWETQKGPELKNPTDAIIYELHIR
DLSTHENSGITHKGKFLGLTETDTTTSTGVKTGLNHIKELGVTHVHLLPAFDYSSIDETK
LEESDFNWGYDPQNYNVPEGSYATDPYHGEVRVKEFKQAIQTLHQNDIGVIMDVVYNHTA
KSADSNLNLIVPDYYYRKNLDGSFSNGSGCGNEIASERAMVRKMIIDSVVYWAKEYKIDG
FRFDLMGLIDIDTMNEIRTELDKINPNILIYGEGWTASSSTLPTNKQALKVNAGELNHIA
VFSDDFRDGIKGHVFESTASGFANGGAGFEETIKFGIVGATKHPQVDYAQVNYSKAPFAK
SPSQTVNYVSAHDNLTLWDKIELTNPEDGMEERLKIHKLSNAMVLTSQGIPFLHAGVEFV
RTKGGNENSFSAGDEINQLDWSRKIGFKDVYDYYRGLIELRKKHPAFRMTTAEEISEHLT
FLEMPTEEMVGYKISGHANGDEWEEIVVLFNANKEEQKIVLDRGDWEVVVNDQVAGIVPI
ENIVGNEVVVPSRSAMVLVKAKGVETSTDQQVDSQNETTRSQAKTIAYIVGGVAVAVVAA
FGVRRRLKNKH
NT seq 3096 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaatatgtggggattgttttagtatgtatactcattttaaatttgtttcaa
ggaatattgcccttggaagctacgcccaatacggaaaaacaattaattattcattattac
agaccagataagcagtatgaggaatggaatctatggatgtggcttgacggaaaagatgga
aacgttaccgaatttactgaagaagatgaatttggtgtaaaggctattattcctttagag
gaaacagctaataaggtaggttttattgtaagaactaatgattgggcaaaagacgtatca
gatgatcgctttgtggcaacaacagaagctatcaatgaaatatggctcgtgtcaggagat
gaaacgatttatacagaagagcctaatcttttgggtggtacagtaatactgccagagcaa
gttaccttgaatgtacattataataggtatgatagaaattatgaagattggaaactatgg
ttatggcctgaaggtaaagaggggataagttataattttgaaaaggaagatgcctatggt
aaggtggcaacctttacagtaaaagacataggatcaatacgtaagttagggttttggctc
tataaaaaagatgtacaaaataaagatgtagaaatagatcgttttatttctactactaaa
gttgatgagaatggaaaaattgatatttacttaaagcaaggagaggaaaaagtgggatac
agtaaagaagaaatgtacattaagcctagtgtgagctgggcaaccatggatacaatggaa
agtatttgtttaggtgttaatgttccttttgaaacaaaggaagatcttaaagcggatttt
agtgtgactaaagctgggaagaaaatagcaatcaataaagtggagttattagatgaaatg
gaaggtggactagctaaaggtgctaagctttacttagctgaaaccattgactttaacggt
atttatgaagtagctaaagaggggtatgaagcgaagatagctacagcaggagagattttt
aatacagaagcttttaaccagctttattattatgagggagacgatttgggagctaattat
caaaaagaacgtacagcttttaaattatgggcacctacagccagtgaagtcgaagtcatc
ctttatgatgcaggtaatgatggtaaagtgctacaagaagtgccaatgacaaaacaagaa
aaaggtacttggagtgctacaattcaaggtgaccaaaatgctgtttattatacttataag
gtacgtattaacggagaatggcgagaagttgtagatccttatgcaagaacaactggagtc
aatggcatgagagctatggtgattgaccttgcagaaacaaacccagaagggtgggaaaca
caaaagggaccagagcttaaaaacccaacagatgccattatttatgaactacatataaga
gatttatcaactcacgagaattcagggattacgcataaaggtaaatttctaggtttaaca
gaaactgacacgacaactagtacaggtgtaaaaacaggccttaatcatataaaagaatta
ggggttacccatgttcatttattaccagcttttgactatagttctattgatgaaaccaag
ttagaagaaagtgattttaactggggctatgatccacaaaattataatgtaccagaaggc
tcttatgccacagatccttatcacggagaagtaagagtaaaagaatttaaacaggctata
cagacgcttcatcaaaatgatatcggtgttattatggatgtggtttacaatcatacggct
aaaagtgcagactccaatttaaatcttattgtaccagactattattatagaaagaattta
gatggtagcttttcaaatggttcaggttgtggcaatgaaatagcttcagaacgggctatg
gtaagaaaaatgattatagattcagtagtttattgggctaaagaatataagattgatggt
tttagatttgaccttatgggcctgatagatattgatacaatgaatgaaatccgtactgaa
ttagataaaatcaatcctaatattttaatttatggtgaaggctggacagcttcttcctct
acattacctacaaataagcaagcgcttaaagtaaatgcaggagaattaaatcatatagct
gtttttagtgatgattttagagatggtattaaagggcatgtttttgaaagtacagcttca
gggttcgcaaatggtggagcagggtttgaagaaacaattaaatttgggattgtaggagca
actaagcatccacaagttgattatgcacaggtaaattattcaaaagcaccttttgcaaaa
tcaccaagtcaaacagttaattatgtatcagctcatgataacttaactttatgggataag
attgaactcactaatccagaagatggcatggaagagagactaaaaattcataaattaagt
aatgcgatggtacttacttcacaaggtattcctttcttacatgcaggtgtagaatttgta
cgtactaagggtggtaatgagaacagtttttcagcaggagatgagattaatcaattagat
tggagtagaaaaattggatttaaagatgtgtatgattattatagaggtcttatagagtta
agaaaaaaacatccagcttttcgaatgactacagcagaagaaattagtgagcatttaact
ttccttgaaatgcctacagaagaaatggtaggttacaaaataagtgggcatgctaatgga
gatgagtgggaagaaattgttgttttatttaatgctaataaggaagaacaaaaaatagta
ttagatagaggagattgggaagtagtcgttaatgatcaagtggcgggtatagtacctata
gagaacatagtaggtaatgaagttgtggtacctagtagaagtgcaatggtattagtaaag
gcaaaaggagtagagacaagtacagatcaacaagtagatagtcaaaatgaaacaaccagg
tctcaagctaaaacaatagcttacattgtaggtggtgttgcagtagcagtagtagctgct
tttggtgtgagaagaaggttgaaaaataagcattaa

DBGET integrated database retrieval system