KEGG   Cellulosilyticum lentocellum: Clole_2965Help
Entry
Clole_2965        CDS       T01448                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
cle  Cellulosilyticum lentocellum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clole_2965
   00052 Galactose metabolism
    Clole_2965
Enzymes [BR:cle01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Clole_2965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3207821..3208867)
Genome map
AA seq 348 aa AA seqDB search
MKIVSKDMTFASGEKVTKYELSNTAGMTVEVLNWGATLTKIVVPDKEGHFENVILEWEDI
NTYENNPGNFGATVGRIAGRIADAKVTLNHQVYHFVKNTYGNTLHGGLVGFDKKAWTGEM
QQTEDSVILTLSYLSPDGEEGFPGNLHVKAIYLLKEDNTLTLTYEATTDKETIVNLTNHA
YFNLSGEAKRSVLGQEVYINSSQICDLNEELIPTGAFIDLDNESAFDFRVPKAIGKDIER
ENPHLKNGYGYDHCWLLNKGEKAAELYDPISGRVMEISTTAPGVVVYTMNHADGVTKLSN
GKEQQRRYGVCFETQRKPIGKNEVFKEEVILKPSEVYRQETTFKFSNR
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagtaagtaaggacatgacctttgcttctggtgaaaaggttacaaaatatgaa
ttaagtaatacagcgggaatgacagtggaagtgttaaattggggggcaacactcactaaa
atagtggttccagataaagaaggtcattttgaaaatgtcattttagagtgggaagatata
aatacctacgagaataatcccggtaattttggagcgacagtaggtagaattgctggtaga
atagcagatgcaaaggtgactttaaatcatcaggtttatcattttgtaaaaaatacctat
ggaaacacattacatggtggtttagttggatttgataaaaaagcttggacgggtgaaatg
cagcaaacagaggattctgttattttaactttaagttatttgagcccagatggagaagaa
ggattcccagggaatttacatgtaaaagccatctatctattaaaagaagataatacactt
actttaacttatgaagctactacagataaggaaacaatcgttaatcttactaatcatgct
tattttaacttgtcaggagaagcgaaacgttctgttttaggacaagaagtgtatattaat
agtagtcagatttgtgacttaaatgaagaacttattcctacaggtgcttttatagatttg
gataacgaaagtgcctttgattttagagtaccaaaagctattggaaaagatattgaacga
gaaaatcctcatttaaaaaatgggtatggttatgatcattgttggttacttaataaaggc
gaaaaagctgcagaattatatgatcctatatcaggacgagtaatggagattagtactact
gccccaggggtagttgtttatactatgaatcacgcagatggtgtaacaaagctttcaaat
ggtaaggaacaacaaagaagatatggtgtgtgttttgaaacacaaagaaagcctattggt
aaaaatgaagtatttaaggaagaggttattctaaaacctagtgaagtttatagacaagaa
acaacatttaaatttagtaacagataa

DBGET integrated database retrieval system