KEGG   Clostridium lentocellum: Clole_2999Help
Entry
Clole_2999        CDS       T01448                                 

Definition
(GenBank) Fructose-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
cle  Clostridium lentocellum
Pathway
cle00010  Glycolysis / Gluconeogenesis
cle00030  Pentose phosphate pathway
cle00051  Fructose and mannose metabolism
cle00680  Methane metabolism
cle01100  Metabolic pathways
cle01110  Biosynthesis of secondary metabolites
cle01120  Microbial metabolism in diverse environments
cle01130  Biosynthesis of antibiotics
cle01200  Carbon metabolism
Module
cle_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clole_2999
   00030 Pentose phosphate pathway
    Clole_2999
   00051 Fructose and mannose metabolism
    Clole_2999
  Energy metabolism
   00680 Methane metabolism
    Clole_2999
Enzymes [BR:cle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Clole_2999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos
Motif
Other DBs
NCBI-ProteinID: ADZ84696
UniProt: F2JMP5
Position
complement(3248676..3250646)
Genome map
AA seq 656 aa AA seqDB search
MEAEEINLKLLKFLAKQYPTMDHAITEMINLQAILNLPKATEHFVSDIHGEYEAFSHVLR
NASGVLKTRIDELFINEMSDKERRAFAILIYYPEKKMKQVADIEEEMNEWYRINLLRVIR
LCKVISSKYTRSKVRKALPKEFAYIMEELLNEQVDTPNKEQYYYEIVDRIISLNKAEAFM
CAFCHLIQRLAIGHLHVLGDIFDRGPRADKVMDILQQYHSVDIQWGNHDILWMGAASGSG
ACIANIIRNACKYSNLETLEDGYGINLLPLATFALDQYKDQDYSLFMPVIDNEWDTKQDD
VRLVALMHMAITFIQFKLEHQLIEKCFDKEMKNRDLLGKINYEEYTITIDGMTHQLNADV
FKGINPKAPYDLSKEEIEVIDRLRSSFLQSSKLQEHIQFMFTNGSMYKVYNNNLLYHGCI
LLTEEGTFKQIQLDGKYYSGKAYLERLEAIVREGYFNVLDKEAKQKGMDIMWYLWCGSNS
PVFGKQKMTTFERYFIQNEETWKEPKNSYYEYLDDEEMAMRLLMEFGINSEEGHIINGHV
PVQVKKGEKPIKAGGKIIVIDGGFTKAYQKITGIAGYTLIYNSFGLQLASHEPFEGVEEA
ITSEKDMVTSMNVIEYIPTRKRVKDTDIGKDIDGQIKALLTLVEYYQLGLLKTKES
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagaagagattaatttgaaactacttaaatttttggcaaaacaatatccaaca
atggatcatgccattacagagatgataaacttacaggcaatattaaatttacctaaggcc
actgaacatttcgtatcagatattcatggagagtatgaggcattttctcatgtacttcgt
aatgcttcaggtgtattaaagaccagaatagatgaactttttatcaatgaaatgtcagat
aaagagagaagagcttttgcgattttaatctattatcctgagaaaaagatgaagcaagtt
gcggatattgaagaagaaatgaatgagtggtataggataaatttattaagagttatcaga
ctatgtaaagtgatttcttctaaatatacacgatcaaaagtaagaaaagcattaccaaaa
gaatttgcatatattatggaagaactacttaatgaacaggtagatacccctaataaggaa
cagtattactatgaaattgtagatcgtattattagtttaaacaaagcagaagctttcatg
tgtgctttttgccatcttattcaaagactagctataggacatttacatgttttaggggat
atttttgatagaggtcctcgtgctgataaggtgatggatattttacagcaatatcactct
gtagatattcagtggggaaatcatgatatactatggatgggagctgcttcaggtagcgga
gcctgtattgctaatattattagaaatgcctgtaaatattctaatttagaaactttagaa
gatgggtatggcatcaatttattgccattagccacatttgctttagaccaatataaggac
caagattatagtttatttatgccggttatagataatgaatgggatacaaaacaagacgat
gtaagattagtcgcattaatgcatatggctattacttttattcagtttaaactagaacat
caacttattgagaaatgctttgataaggaaatgaagaatagagatttattaggtaaaatt
aattatgaggaatataccattacaattgacggaatgacacatcagttaaatgctgatgtt
tttaaggggattaatccgaaagcaccatatgacttatccaaagaagaaatagaggtaata
gatagattaagaagttcttttttacaaagtagtaagttacaagaacatattcaatttatg
tttactaatgggagtatgtacaaagtatacaataataacttgctttatcatggatgcatt
ttgttaacagaagaaggaacatttaagcagatacaattagatggtaaatattattctggt
aaagcctatctagagcgtttagaagcaattgttagagaaggatattttaatgtattagat
aaagaagcaaaacaaaaaggtatggatataatgtggtatctttggtgcggtagtaattct
ccggtatttggaaagcaaaaaatgactacctttgagagatacttcatacaaaatgaggaa
acttggaaggaacctaaaaatagttattatgagtacctagatgatgaggaaatggcaatg
agattattaatggagtttggtattaatagtgaagaagggcacattattaatgggcatgta
ccggtacaggtgaagaagggggaaaaacctatcaaagcaggaggaaaaattattgttata
gatgggggattcacaaaggcttatcaaaaaattacaggtatagctggctatactttaatt
tataattcatttgggctacaacttgcatctcatgaaccatttgaaggagtggaagaagca
attacttctgagaaggatatggtaacttctatgaatgtgatagaatacataccaacccgt
aaacgagtgaaggatacagatatcggaaaagatattgatggacaaattaaagcactccta
acacttgtagagtattatcaattaggtttattaaaaacaaaagaaagttag

DBGET integrated database retrieval system