KEGG   Clostridium lentocellum: Clole_3024Help
Entry
Clole_3024        CDS       T01448                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cle  Clostridium lentocellum
Pathway
cle03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cle00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Clole_3024
Enzymes [BR:cle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Clole_3024
DNA repair and recombination proteins [BR:cle03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Clole_3024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 HHH_5 AAA_11 Viral_helicase1 Helicase_RecD PIF1 T2SSE UvrD_C ArgK NTPase_1 AAA DEAD TIP49 AAA_22 AAA_12 UvrD-helicase TrwB_AAD_bind HHH_2 AAA_5 AAA_28 SRP54 AAA_29 NACHT TsaE DUF2075 AAA_16 Thymidylate_kin CbiA HHH_3 ResIII
Motif
Other DBs
NCBI-ProteinID: ADZ84721
UniProt: F2JNE5
Position
complement(3276540..3278684)
Genome map
AA seq 714 aa AA seqDB search
MENLRGVVERITYANEDTGYSVIKIRCKGYHELVTVVGSMATVNVGAVITMKGFWSSNPK
YGRQFEAKEWEETLPASIYGIEKYLGSGLIKGIGPVYAKKIVNLFKEQTLDIIEEEPDRI
IEVPGIGKKRVEMIKKAWQDQKEIKNIMIFLQSYGVSTSFGSRIYKYYGNESIEVVKENP
YQLADDIYGIGFKTADGVAAKLGIEKDSFKRCRAGLFYTLSQLSEEGHCFARTEQLVAKC
VEILEVEETKVIMTIDHLIKEKELIKEEPDAIYLPPFYFSERGVAKRLKEIMAGHTLRQV
KKSDEVIAFLERTEQMTYDDIQREAIHLASRSKVMLLTGGPGTGKTTTTHGIISLFKESG
MEVLLTAPTGRAAKRMSEATGMEAKTIHRLLECKPPEGYKKNEDHPLVGDVLIIDEASMI
DIILMYNLLKAIPDHMILVIVGDIDQLPSVGAGNVLQDMIASGVIPTIKLERIFRQAMGS
KIITNAHKINKGENPDLRGGKDSNFFFIEQEESQGVIDTIVKLCTKRLPQYYKVNPIKDI
QILTPMQRSETGAANLNTVLQSALNKNTLHLKRGATEYRLNDKVMQIRNNYDKEVFNGDV
GFISDIDLEERTLKVTFDEREIEYEALELDELVLAYATTIHKAQGSEYPIVVMPLTFSHY
VMLQRNLIYTGITRAKKVVVLVGNRQAIYVAVKNNEVKNRNTKLAERLQSESVI
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatttacgtggtgtagtagagcgcattacttatgctaatgaggatactggttat
agtgtgattaagattaggtgtaaaggctatcatgagcttgtaacggtagtggggagtatg
gctactgttaatgtaggtgcggttattactatgaaagggttttggtcgagcaatcctaaa
tatggtaggcagtttgaggctaaggaatgggaggagactttgcctgctagtatttatggt
atagagaagtatttaggcagtgggcttattaagggaattgggcctgtgtatgctaagaag
attgttaatttatttaaggagcagacactagatattatcgaagaagaacctgatcggatt
atagaggttcctgggataggtaaaaaacgtgtagagatgattaagaaagcttggcaggat
caaaaggagattaagaacattatgattttcttacaatcctatggtgtatccacttctttt
ggaagtcgtatttataaatactatggcaatgagagtattgaggtggttaaagaaaatcct
tatcagctagcagatgatatttatgggattggttttaaaacagctgatggggtagcagct
aagctagggatagagaaggattcttttaaaagatgccgtgcagggcttttttacactctg
agtcaactctcagaggaaggacactgttttgctagaacagagcaattagtggctaaatgt
gtagagatattagaggtagaagaaacaaaggtgataatgactatcgaccatttgattaaa
gaaaaggaactgattaaagaagaaccagatgccatttacttaccacctttttattttagt
gaaagaggggtagcgaaacgtttaaaggagattatggcaggtcatacgctaaggcaagtg
aaaaagagtgatgaggttattgctttcttagaaagaacggagcagatgacttatgatgat
attcaaagagaagccattcatcttgcaagtaggtctaaggtgatgctattgacaggtggt
ccgggaacaggaaagacaaccactactcacgggattattagtttgtttaaagagtcaggg
atggaagtgctgttgactgcaccaacaggaagagcggctaaaaggatgagtgaagccact
ggtatggaagctaagaccattcacaggctattagagtgtaagccacctgaggggtataag
aaaaatgaggatcatccattagtaggtgatgtccttataatagatgaagcttcaatgata
gatattatactgatgtataatttattaaaagccattccagatcatatgattcttgttatt
gttggagacattgatcagcttccttctgtaggtgcaggcaatgtgcttcaagatatgata
gcttctggcgttatccctactattaagctagaacgtatttttagacaagctatgggaagt
aaaattattaccaatgcccacaagattaataaaggagaaaatccggatttaagaggtgga
aaggatagtaatttcttcttcatagagcaagaagagagtcagggggttattgatacgatt
gtcaaactatgtaccaaaaggctgcctcagtattataaagtgaatccaatcaaagacatt
cagatactaacacctatgcagcgttctgaaacaggtgctgctaacctcaatacagtactg
caatcagcacttaataaaaatacgcttcatttaaaacgaggggctactgaatataggctc
aatgacaaagtgatgcagatacgaaataactatgataaggaagtctttaacggagatgta
ggctttatttcagacattgatttagaggagcgtacgcttaaagtgacctttgatgagcgg
gaaatagagtatgaagcattagaattagatgaacttgtactggcttatgccaccacgatt
cataaggcccagggaagtgaatatcctattgtagtcatgcctcttacttttagtcattat
gtgatgctccagcgtaatttaatttatacaggtataacgagagctaaaaaggtagtggtg
ttggtaggtaatcgtcaagcgatttatgtagcagtgaagaacaatgaagtaaaaaataga
aataccaaattagctgagagactacaaagtgaatccgtgatttag

DBGET integrated database retrieval system