KEGG   Cellulosilyticum lentocellum: Clole_3654Help
Entry
Clole_3654        CDS       T01448                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cle  Cellulosilyticum lentocellum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Clole_3654
Enzymes [BR:cle01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Clole_3654
Exosome [BR:cle04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Clole_3654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3984167..3985135)
Genome map
AA seq 322 aa AA seqDB search
MLERPRRLRVSDSIRSLVRETKLHVEELIYPLFIVEGENIKSEIASMPEVYHFSIDKLKE
EIEEIKALGICAVLLFGIPKEKDTCGSEAFAKDGIVQKAVRLIKSIAPEIIVITDVCMCE
YTSHGHCGILTESGYVDNDKTLDFLTKIAISHAEAGADMVAPSDMMDGRIVAIREGLDEA
GYINVSIMAYSAKYASSFYGPFREAAHSAPSFGNRKTYQMDPANTNEALREGQLDCQEGA
DIIMVKPALSYLDIIYRFKANLNKPIAAYNVSGEYSMLKLAVKNGLLSEEAIYESVLSIK
RAGADIIITYFAKDIARQLRVK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaagaccaagaagattaagagtaagtgattcaataagaagtttagtaagagaa
acaaagcttcatgtggaagaactcatttatccactttttatagtagaaggtgaaaatata
aaaagtgagattgcctctatgccagaggtttatcatttttctatagataagcttaaagag
gagatagaggaaattaaagcattgggtatttgtgctgtattactatttggtattccaaag
gaaaaggatacatgtggtagtgaagcctttgccaaagatggtattgtacaaaaagcagtt
cgccttattaagtctatagccccagagatcatagtgattacagatgtttgtatgtgcgaa
tacacaagccatgggcattgtggcattttaacagaaagtggttatgtagataatgataaa
acattagatttcttaactaagattgcaataagtcatgcagaggcaggggcggatatggta
gcaccttcagatatgatggatggacgtattgtagctattagagaagggttagatgaggca
ggctatataaatgtaagtattatggcttatagtgctaagtatgcttctagtttctatgga
cctttcagagaagcagcacattcagcccctagctttgggaaccgtaagacttatcagatg
gaccccgccaatacgaatgaagcattacgtgaaggtcagctagattgccaagagggagcg
gatattattatggtcaagccagcactttcttatttagatattatttatcgctttaaagcc
aatcttaataagcctattgcggcatataacgtaagtggggagtattctatgcttaaatta
gctgttaaaaatggcttacttagtgaggaagcaatatatgaaagtgttctttctattaag
cgtgcaggtgctgatatcattattacttattttgcaaaggacatagcgcgccaactaaga
gttaaataa

DBGET integrated database retrieval system