KEGG   Clostridium lentocellum: Clole_3655Help
Entry
Clole_3655        CDS       T01448                                 

Definition
uroporphyrin-III C-methyltransferase (EC:2.1.1.107 4.2.1.75)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cle  Clostridium lentocellum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cle00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3985204..3986721)
Genome map
AA seq 505 aa AA seqDB search
MTGKVYLIGAGPGDYKLLTLKGKECLEEADVIIYDRLANEDYLRISSSTCECINVGKASS
NHTMPQDKINELLAAKAKEGKVVVRLKGGDPYVFGRGGEEGEYLFDRGIPFEVIPGVTSA
IGGLCYAGIPITHRECASSFHVITGHLKDGSKDEINWEALASLKGTLVFLMGISNLKKIT
ENLLGAGKVKETPVGLVSWATRYNQSVVIGTLENIYEKALEKGIKPPTMIVIGEVVNLRE
KLNFFEEKPLFGKQIVVTRTRKQSSQLMEMINDLGGRAIEFPTIEITPIKENTRLKVAIE
HLKQYTYLVFTSPNAVEVFFEALEASGKDARVLAHLKIAVIGEATKKALKQKGIVADRMP
TKAVAESLADCLKKELTNKDYILLPDSAIAREGLVSSLEAVCKVDEIPLYTTVPVRNVAK
GEMSSKELVERLIADEIDYMTFTSSSTVHHLIGRIGQEHIAALAHAKLISIGEITTHTLK
TYGLEVYKEAKKATMTDLVDCMEEK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgactggtaaagtatatttaataggtgcaggtccaggtgattacaaactcctaacacta
aagggaaaagaatgtttagaagaagcggatgtcattatttatgaccgcttagcaaatgaa
gattacttgaggataagcagctctacgtgtgaatgtattaatgttgggaaagcctctagt
aaccacaccatgcctcaagataaaattaatgagctgcttgcagcaaaagctaaagaaggc
aaagtggtagttagacttaagggaggagacccttatgtttttggaagaggtggtgaggaa
ggtgaatatctctttgatagagggattccttttgaagtcataccaggtgttacttctgct
ataggtggattgtgctatgcgggcattcctattactcacagagaatgtgcatcttctttt
cacgttattacaggtcacttaaaagatggttcgaaggatgaaataaattgggaagcttta
gcaagtttaaaggggaccttagtatttttaatgggtattagtaatttaaagaagattact
gaaaatcttttaggagcaggtaaggtaaaagagacaccagtagggctagtgagctgggcc
acgaggtataatcagagcgttgtaataggaactctagagaatatttatgaaaaggcacta
gaaaaaggtataaagcctcctacgatgattgttattggtgaagtcgtgaatctaagagaa
aagttaaattttttcgaagaaaaaccactctttggcaagcaaattgtagtgacaagaacg
agaaaacaaagcagtcagctgatggagatgattaatgatttaggtggaagagctatagaa
tttcctactatagagattacacctattaaagagaatactaggcttaaagtagctattgag
caccttaaacagtatacatatttggtatttacaagtcctaatgcagtagaggttttcttc
gaggcattagaagcaagtggcaaagatgcaagggtacttgctcatttgaaaatagctgtt
ataggtgaagcaacgaaaaaagctttaaagcaaaaaggaatagttgctgataggatgcca
actaaagctgttgcagaaagtttagcagattgtttaaaaaaagaacttacaaataaggat
tatatactgcttcctgactcagctattgcacgagaaggtttagtgagtagtttggaagca
gtctgcaaggtagatgaaattccactctataccacagttccagtaagaaatgtagcaaag
ggtgaaatgagtagcaaagagctagtagaaaggctgatagcagatgaaatagattatatg
acttttactagttcgtctacagtacatcatttgattggtcgtatagggcaagaacatata
gcagccctagcccatgcaaagcttatttctataggggaaataaccactcatacacttaag
acgtatggcctagaggtatacaaagaagctaagaaagcgaccatgacggatttagtagat
tgcatggaggaaaagtag

DBGET integrated database retrieval system